SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSBTAP00000013364 from Bos taurus 76_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSBTAP00000013364
Domain Number 1 Region: 375-569
Classification Level Classification E-value
Superfamily L domain-like 6.01e-38
Family Ngr ectodomain-like 0.0074
Further Details:      
 
Domain Number 2 Region: 73-285
Classification Level Classification E-value
Superfamily L domain-like 1.1e-34
Family Ngr ectodomain-like 0.0018
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSBTAP00000013364   Gene: ENSBTAG00000010129   Transcript: ENSBTAT00000013364
Sequence length 901
Comment pep:known_by_projection chromosome:UMD3.1:12:62666724:62669717:1 gene:ENSBTAG00000010129 transcript:ENSBTAT00000013364 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MHTCCPPVTLEQDLHRKMQSWMLQTLAFALTSLVLSCAETIDYYGEICDNACPCEEKDGI
LTVSCENRGIISLSEISPPRFPIYHLLLSGNLLSRLYPNEFVNYTGASILHLGSNVIQDI
ETGAFHGLRGLRRLHLNNNKLELLRDDTFLGLESLEYLQVDYNYISVIEPNAFGKLHLLQ
VLILNDNLLSSLPNNLFRFVPLTHLDLRGNRLKLLPYVGLLQHMDKVVELQLEENPWNCS
CELISLKDWLDSISYSALVGDVVCETPFRLHGRDLDEVSKQELCPRKLISDYEMRPQTPL
STTGYLHTTPASVNSVATSSSAVYKPPLKPPKGTRQPNKPRVRPTSRQPSKDLGYGNYGP
SIAYQTKSPVPLECPTACTCNLQISDLGLNVNCQERKIESIAELQPKPYNPKKMYLTENY
IALVRRSDFLEATGLDLLHLGNNRISMIQDRAFGDLTNLRRLYLNGNRIERLSPELFYGL
QSLQYLFLQYNLIREIQPGTFDPVPNLQLLFLNNNLLQTLPSGVFSGLTLLRLNLRSNHF
TSLPVSRVLDQLTSLIQIDLHDNPWDCTCDVVGMKLWVEQLKAGVLVDEVICKAPKKFAE
TDMRSIKSELLCPDYSDVVVSTPAPSSIQVPARTSAVTPAVRLNATGAPAGLGAGGGAAS
SVPLSVLILSLLLVFIMSVFVAAGLFVLVVKRRKKHQSDHASTHNSDVSSFNMQYSVYGE
GGGGGGGSGGAGVHPHAHAQHRAPAPPQPQPPPPVQLQPAGEDERRESHHLRSPAYSVST
IEPREDLLSPVQDADRFYRGILEPDKHCATTPAGNSLPEYPKFPCSPAAYTFSPNYDLRR
PHQYLHPGAGDSRLREPVLYSPPSAVFVEPNRNEYLELKAKLNVEPDYLEVLEKQTTFSQ
F
Download sequence
Identical sequences E1B8X9
ENSBTAP00000013364 ENSBTAP00000013364

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]