SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSBTAP00000013397 from Bos taurus 76_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSBTAP00000013397
Domain Number 1 Region: 56-301
Classification Level Classification E-value
Superfamily Carbonic anhydrase 7.46e-90
Family Carbonic anhydrase 0.00000000462
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSBTAP00000013397   Gene: ENSBTAG00000010151   Transcript: ENSBTAT00000013397
Sequence length 310
Comment pep:known_by_projection chromosome:UMD3.1:18:13389828:13412237:-1 gene:ENSBTAG00000010151 transcript:ENSBTAT00000013397 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MVRPPVLGWSHLKSSGLSLLAKQIWGTLRSHLLRPARWCSQVPCAQRRRNDALHPVWKGP
ASVPGGTRQSPINIRWRDSVYDPQLQPLGVSYNAEACLYVWNTGYLFQVEFDDSTEGSGI
SGGPLENHYRLKQFHFHWGAVNEWGSEHTVDDRVYPAELHLVHWNAVKYQNYTDAVTGAD
GLAVVGVFLKLGARHEELQELVAVLPDIKHKDARAALGPFQPSCLLPACQDYWTYPGSLT
TPPLSESVTWIIHKKPIEVAQDQLAAFRSLLFSVPGEEEKTMVNNYRPLQPLMNRKVRSS
FQATHEGARL
Download sequence
Identical sequences E1BAD9
ENSBTAP00000013397 9913.ENSBTAP00000013397 ENSBTAP00000013397 NP_001179338.1.59421 NP_001179338.1.76553 XP_019835625.1.53367

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]