SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSBTAP00000013433 from Bos taurus 76_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSBTAP00000013433
Domain Number 1 Region: 1204-1515
Classification Level Classification E-value
Superfamily (Phosphotyrosine protein) phosphatases II 6.51e-111
Family Higher-molecular-weight phosphotyrosine protein phosphatases 0.0000000000842
Further Details:      
 
Domain Number 2 Region: 1480-1768
Classification Level Classification E-value
Superfamily (Phosphotyrosine protein) phosphatases II 1.19e-104
Family Higher-molecular-weight phosphotyrosine protein phosphatases 0.000000000931
Further Details:      
 
Domain Number 3 Region: 194-388
Classification Level Classification E-value
Superfamily Fibronectin type III 2.89e-45
Family Fibronectin type III 0.00054
Further Details:      
 
Domain Number 4 Region: 386-583
Classification Level Classification E-value
Superfamily Fibronectin type III 4.06e-43
Family Fibronectin type III 0.00051
Further Details:      
 
Domain Number 5 Region: 686-878
Classification Level Classification E-value
Superfamily Fibronectin type III 1.11e-35
Family Fibronectin type III 0.00078
Further Details:      
 
Domain Number 6 Region: 539-687
Classification Level Classification E-value
Superfamily Fibronectin type III 9.89e-31
Family Fibronectin type III 0.00058
Further Details:      
 
Domain Number 7 Region: 11-103
Classification Level Classification E-value
Superfamily Immunoglobulin 1.42e-17
Family I set domains 0.01
Further Details:      
 
Domain Number 8 Region: 106-200
Classification Level Classification E-value
Superfamily Immunoglobulin 2.74e-16
Family I set domains 0.016
Further Details:      
 
Domain Number 9 Region: 887-1009,1069-1115
Classification Level Classification E-value
Superfamily Fibronectin type III 0.000000000169
Family Fibronectin type III 0.0044
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSBTAP00000013433   Gene: ENSBTAG00000010178   Transcript: ENSBTAT00000013433
Sequence length 1776
Comment pep:known_by_projection chromosome:UMD3.1:8:36575709:36797407:1 gene:ENSBTAG00000010178 transcript:ENSBTAT00000013433 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
LAEDQIPRGFPTIDMGPQLKVVERTRTATMLCAASGNPDPEITWFKDFLPVDTSNNNGRI
KQLRSGALQIEQSEESDQGKYECVATNSAGTRYSAPANLYVRVRRVPPRFSIPPTNHEIM
PGGSVNITCVAVGSPMPYVKWMLGAEDLTPEDDMPIGRNVLELNDVRQSANYTCVAMSTL
GVIEAIAQITVKALPKPPGTPVVTESTATSITLTWDSGNPEPVSYYIIQHKPKNSEEPYK
EIDGVATTRYSVAGLSPYSDYEFRVVAVNNIGRGPPSEPVLTQTSEQAPSSAPRDVQARM
LSSTTILVQWKEPEEPNGQIQGYRVYYTMDPTQHVNNWMKHNVADSQITTIGNLVPQKTY
SVKVLAFTSIGDGPLSSDIQVITQTGVPGQPLNFKAEPESETSILLSWTPPRSDTIASYE
LVYKDGEHGEEQRITIEPGTSYRLQGLRPNSLYYFRLAARSPQGLGASTAEISARTMQSK
PSAPPQDISCTSPSSTSILVSWQPPPVDKQNGIITEYSIKYTAVDGEDDKPHEILGIPSD
TTKYLLEQLEKWTEYRITVTAHTDVGPGPESLSVLIRTDEDVPSGPPRKVEVEAVNSTSV
KVSWRSPVPNKQHGQIRGYQVHYVRMENGEPRGQPMLKDVMLADAQDMIISGLQPETSYS
LTVTAYTTKGDGARSKPKLVSTTGAVPGRPRLVINHTQMNTALIQWHPPVDTFGPLQGYR
LKFGRKDVEPLTTLEFSEKEDHFTATDIHKGASYIFRLSARNKVGFGEEMVKEISVPEEV
PTGFPQNLQSEGTTSTSTQLSWQPPVLAERNGIITKYTLLYRDINIPLLPVEQLIVPADT
TLTLSGLKPDTTYDVKVRAHTSKGPGPYSPSVQFRTLPVNQAVFAKNFHVKAVMKTSVLL
SWEIPENYNSAMPFKILYDDGKMVEEVDGRATQKLIVNLKPEKSYSFVLTNRGNSAGGLQ
HRVTAKTAPDVLRTKPAFIGKTNLDGMITVQLPEVPANENIKGYYIIIVPLKKSRGKFIK
PWESPDEMELDELLKEISRKRRSLRHGREVELKPYIAAHFDVLPTEFTLGDDKHYGGFTN
KQLQSGQEYVFFVLAVMEHAESKMYATSPYSDPVVSMDLDPQPITDEEEGLIWVVGPVLA
VVFIICIVIAILLYKRKRAESDSRKSSIPNSKEVPSHHPTDPVELRRLNFQTPGMASHPP
IPILELADHIERLKANDNLKFSQEYESIDPGQQFTWEHSNLEVNKPKNRYANVIAYDHSR
VLLSAIEGIPGSDYVNANYIDGYRKQNAYIATQGSLPETFGDFWRMIWEQRSATVVMMTK
LEERSRVKCDQYWPSRGTETHGLVQVTLLDTVELATYCVRTFALYKNGSSEKREVRQFQF
TAWPDHGVPEHPTPFLAFLRRVKTCNPPDAGPMVVHCSAGVGRTGCFIVIDAMLERIKHE
KTVDIYGHVTLMRAQRNYMVQTEDQYIFIHDALLEAVTCGNTEVPARNLYAYIQKLTQIE
TGENVTGMELEFKRLASSKAHTSRFISANLPCNKFKNRLVNIMPYESTRVCLQPIRGVEG
SDYINASFIDGYRQQKAYIATQGPLAETTEDFWRMLWEHNSTIVVMLTKLREMGREKCHQ
YWPAERSARYQYFVVDPMAEYNMPQYILREFKVTDARDGQSRTVRQFQFTDWPEQGVPKS
GEGFIDFIGQVHKTKEQFGQDGPISVHCSAGVGRTGVFITLSIVLERMRYEGVVDIFQTV
KMLRTQRPAMVQTEDQYQFCYRAALEYLGSFDHYAT
Download sequence
Identical sequences F1MJR2
9913.ENSBTAP00000013433 ENSBTAP00000013433 ENSBTAP00000013433

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]