SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSBTAP00000013571 from Bos taurus 76_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSBTAP00000013571
Domain Number 1 Region: 60-103
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000000000000266
Family EGF-type module 0.00023
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSBTAP00000013571   Gene: ENSBTAG00000010273   Transcript: ENSBTAT00000013571
Sequence length 164
Comment pep:known_by_projection chromosome:UMD3.1:6:91065006:91071187:1 gene:ENSBTAG00000010273 transcript:ENSBTAT00000013571 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MQHVYPFPYWISLLCEIVFYLLQAVFSTTVIPSCIPGESGDNCTALVQTEDNPRVAQVSI
TKCSADMNGYCLHGQCIYLVDMSENYCRCEVGYTGVRCEHFFLTVQKPLSKEYVALTVIL
VILFLVIVAGSIYYFCRWYRNRKSKEPKKEYERVTSGDPALPQV
Download sequence
Identical sequences E1BBE2
ENSBTAP00000013571 9913.ENSBTAP00000013571 ENSBTAP00000013571

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]