SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSBTAP00000013680 from Bos taurus 76_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSBTAP00000013680
Domain Number 1 Region: 389-518
Classification Level Classification E-value
Superfamily Growth factor receptor domain 0.0000000000267
Family Growth factor receptor domain 0.013
Further Details:      
 
Domain Number 2 Region: 325-363
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000000000151
Family EGF-type module 0.0048
Further Details:      
 
Domain Number 3 Region: 292-328
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000000232
Family EGF-type module 0.01
Further Details:      
 
Weak hits

Sequence:  ENSBTAP00000013680
Domain Number - Region: 365-400
Classification Level Classification E-value
Superfamily EGF/Laminin 0.018
Family EGF-type module 0.0081
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSBTAP00000013680   Gene: ENSBTAG00000010361   Transcript: ENSBTAT00000013680
Sequence length 685
Comment pep:known chromosome:UMD3.1:10:36577285:36586360:1 gene:ENSBTAG00000010361 transcript:ENSBTAT00000013680 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MAVASRRASGWALLLLVALWQQPAAGSGVFQLQLQEFANERGVLASGRPCEPGCRTFFRV
CLKHFQAVVSPGPCTFGSVSTPVLGTNSFAVGDNSSGGGRNPLQLPFNFTWPGTFSLIIE
AWHAPGDDLRPEALPPDALISKIAIQGSLAVGQNWLLDEQTSPLTRLRYSYRVICSDNYY
GDSCSRLCKKRNDHFGHYVCQPDGSLSCLPGWTGEYCEQPICLSGCHEQNGYCSKPAECI
CRPGWQGRLCNECIPHNGCRHGTCSTPWQCTCDEGWGGLFCDQDLNYCTHHSPCKNGATC
SNSGQRSYTCTCRPGYTGVDCELELSECDSNPCRNGGSCKDQEDGYHCLCPPGYYGLHCE
HSTLSCADSPCFNGGSCRERNQGTSYACECPPNFTGSNCEKKVDRCTSNPCANGGQCLNR
GPNRVCRCRPGFTGAHCEINISDCARSPCVHGGTCHDLENGFVCTCPAGFSGRRCEVRMP
AEACASGPCFNGATCYPGLPPDNFVCNCPYGFVGSRCEFRMSMPPTFPWVAVSLGVGLVV
VLVLLCMVAVAVRQLRLRRPDGGSREAMNNLSDFQKDNLIPTAQLKNTNQKKELEVDCGL
DKSNCGKQQNHTLDYNLAPGLLGRGILPGKYSHSDKSLGEKAPLRIHSEKPECRISAICS
PRDSMYQSVCLISEERNECVIATEV
Download sequence
Identical sequences Q0V7L8
ENSBTAP00000013680 9913.ENSBTAP00000013680 ENSBTAP00000013680 NP_001069247.1.59421 NP_001069247.1.76553 XP_019824115.1.53367

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]