SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSBTAP00000013790 from Bos taurus 76_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSBTAP00000013790
Domain Number 1 Region: 705-977
Classification Level Classification E-value
Superfamily Protein kinase-like (PK-like) 1.94e-68
Family Protein kinases, catalytic subunit 0.0000000232
Further Details:      
 
Domain Number 2 Region: 322-513
Classification Level Classification E-value
Superfamily L domain-like 1.76e-47
Family L domain 0.000000107
Further Details:      
 
Domain Number 3 Region: 28-204
Classification Level Classification E-value
Superfamily L domain-like 2.1e-45
Family L domain 0.0000002
Further Details:      
 
Domain Number 4 Region: 499-628
Classification Level Classification E-value
Superfamily Growth factor receptor domain 1.24e-20
Family Growth factor receptor domain 0.0000000595
Further Details:      
 
Domain Number 5 Region: 179-332
Classification Level Classification E-value
Superfamily Growth factor receptor domain 1.23e-18
Family Growth factor receptor domain 0.0000000291
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSBTAP00000013790   Gene: ENSBTAG00000010444   Transcript: ENSBTAT00000013790
Sequence length 1336
Comment pep:known chromosome:UMD3.1:5:57539933:57560884:-1 gene:ENSBTAG00000010444 transcript:ENSBTAT00000013790 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MRVNRALQVLGFLLSLARGSEVGNSQAVCPGTLNGLSVTGDAENQYQTLHKLYEKCEVVM
GNLEIVLTGHNADLSFLQWIREVTGYVLVAMNEFSTLPLPNLRVVRGTQVYDGKFAIFVM
LNYNTNSSHALRQLRLTQLTEILSGGVYIEKNEKLCHMDTIDWRDIVRDRDAEIVVKNNG
KTCPPCHEACKGRCWGPGPEDCQTLTKTICAPQCNGHCFGPNPNQCCHDECAGGCSGPQN
TDCFACRLFNDSGACVRQCPQPLVYNKLTFQLEPNPHTKYQYGGVCVASCPHNFVVDQTS
CVRACPPDKMEVDKNGLKICEPCGGLCPKACEGTGSGSRFQTVDSSNIDGFVNCTKILGN
LDFLITGLNGDPWHKIPALDPEKLNVFRTVREITGYLNIQSWPPHMHNFSVFSNLTTIGG
RSLYNRGFSLLIMKNLNVTSLGFRSLKEISAGRIYISANRQLCYHHSLNWTRLLRGPSEE
RLDIKHNRPRRDCVAEGKVCDPLCSGGCWGPGPGQCLSCRNYSRGGVCVTHCNFLNGEPR
EFAHEAECFSCHQECQPMEGTVTCNGSGSDACAQCAHFRDGPHCVSSCPFGVLGAKGPIY
KYPDAQNECRPCHENCTQGCKGPELQDCLGQLLPLISKTHLAMALTVVVGLAVTFLILGS
TFLYWRGRKIQNKRAMRRYLERGESVEPLDPSEKANKVLARVFKETELRKLKVLGSGIFG
TVHKGVWIPEGESIKIPVCIKVIEDKSGRQSFQAVTDHMLAIGSLDHAHIVRLLGLCPGS
SLQLVTQYLPLGSLLDHVRQHRGALGPQLLLNWGVQIAKGMYYLEEHGMVHRNLAARNVL
LKSPSQVQVADFGVADLLPPDDKQLLYNEAKTPIKWMALESIHFGKYTHQSDVWSYGVTV
WELMTFGAEPYAGLRLAEIPDLLEKGERLAQPQICTIDVYMVMVKCWMIDENIRPTFKEL
ANEFTRMARDPPRYLVIKRESGPGITPGAEPPPLTNKELEEVELEPELDLDLELEAEEEN
LATTLGSALSLPIGTLNRPRGSQSLVSPSSGYMPMNQGNLGEVGQESAVFGGNERYPRPA
SLHPMPRGRLASESSEGHVTGSEAELQEKVSMCRSQSRSPRPRGDSAYHSQRHSLLTPVT
PQSPPGLEEEDVNGYVMPDTHIKGTSSREGTLSSVGLSSVLGTEDDDDEEYEYMNRRRRC
SPSRPPRPSSLEELGYEYMDVGSDLSASLGSTQSCPLNPVPNMPNASTTPDEDYEYMNRR
RGGGGPGGDYAAMDACPASEQGYEEMRAFQGPVLHGPQVHYARLKTLRSLEATDSAFDNP
DYWHSRLFPKANAQRI
Download sequence
Identical sequences A6QR62
ENSBTAP00000013790 NP_001096575.1.59421 NP_001096575.1.76553 ENSBTAP00000013790

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]