SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSBTAP00000013852 from Bos taurus 76_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSBTAP00000013852
Domain Number 1 Region: 430-468
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000000274
Family EGF-type module 0.014
Further Details:      
 
Domain Number 2 Region: 315-358
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000000365
Family EGF-type module 0.0095
Further Details:      
 
Domain Number 3 Region: 354-396
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000000382
Family EGF-type module 0.01
Further Details:      
 
Domain Number 4 Region: 277-311
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000000566
Family EGF-type module 0.0071
Further Details:      
 
Domain Number 5 Region: 388-428
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000106
Family EGF-type module 0.0076
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSBTAP00000013852   Gene: ENSBTAG00000010483   Transcript: ENSBTAT00000013852
Sequence length 603
Comment pep:known_by_projection chromosome:UMD3.1:18:49443971:49451079:1 gene:ENSBTAG00000010483 transcript:ENSBTAT00000013852 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MVAPQMPQLLSSTVILALFFLPQAQPAGVFELQIHSFGPGPGPGTPRSPCKAGGSCRLFF
RVCLKPGLSEETAEAPCTLGAALSARGPVYTAQPGALAPELRLPDGLLRVPFRDAWPGTF
SLIIETWREELGGQIGGAAWSLLARVAGRRLLAAGGPWTRDVQRAGAWELRFSYRARCEP
PAVGAACARLCRSRGAPLRCDPELRPCAPVEEECEAPPVCRAGCSPEHGFCEQPDECRCL
EGWTGPLCTIPVSSSSCLSSRGPSSATTGCLVPGPGPCDGNPCANGGSCSETLGSFECTC
PRGFYGLRCEVSGVTCADGPCFNGGLCVGGADPDSAYICHCPPGFQGSNCEKRVDRCSLQ
PCRNGGLCLDLGHALRCRCRAGFAGPRCEHDLEDCTGHTCANGGTCLEGGGARRCSCALG
FGGRDCRERADPCAARPCAHGGRCYAHFSGLVCACAPGYMGARCEFPVHPDGAGALPAAQ
PGLREGDPQRFLLPPALGLLVAAGLAGAALLLVHVRRRGPSRDTGPRLLAGTPEPSVHAL
PDALNNMRTQEGPGDGPSPSSDWNHPEDGDARSIYVISAPSVYAREMTFGPQEVGSFELE
LRH
Download sequence
Identical sequences E1B9I8
ENSBTAP00000013852 ENSBTAP00000013852

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]