SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSBTAP00000013953 from Bos taurus 76_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSBTAP00000013953
Domain Number 1 Region: 8-126
Classification Level Classification E-value
Superfamily Cgl1923-like 0.000000157
Family Cgl1923-like 0.017
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSBTAP00000013953   Gene: ENSBTAG00000010552   Transcript: ENSBTAT00000013953
Sequence length 264
Comment pep:known chromosome:UMD3.1:24:43515583:43525527:1 gene:ENSBTAG00000010552 transcript:ENSBTAT00000013953 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MFVPSGDSVPDLAGCTLLMPAVSVGNVGQLAIDLIISTLNMHKIGYFYTDCLVPMVGNNP
YATAEENSAELSINAEVYALPSKKLVALQLRSIFIKYKSKSFCEKLLSWVKCSGCAKVVV
LSSSHSYHRNDLQLRSTPFRYLLTPSMQKSVQNKIQSLNWEEMEKTPCIPEIDDSEFCVR
VPGGGITKLLYDEGCSKEIPIAILLKFVSEGDNIPDALGLVEYLNEWLQIIKPHCEDPTA
SSLPWKMPSSWRLLFGSGLPPALF
Download sequence
Identical sequences L8IUH5 Q2NL24
NP_001039830.1.59421 NP_001039830.1.76553 XP_005892423.1.15283 XP_019842486.1.53367 ENSBTAP00000013953 ENSBTAP00000013953 9913.ENSBTAP00000013953

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]