SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSBTAP00000013969 from Bos taurus 76_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSBTAP00000013969
Domain Number 1 Region: 9-292
Classification Level Classification E-value
Superfamily (Phosphotyrosine protein) phosphatases II 1.84e-97
Family Higher-molecular-weight phosphotyrosine protein phosphatases 0.000000000319
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSBTAP00000013969   Gene: ENSBTAG00000010563   Transcript: ENSBTAT00000013969
Sequence length 388
Comment pep:known chromosome:UMD3.1:24:43539648:43607714:-1 gene:ENSBTAG00000010563 transcript:ENSBTAT00000013969 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MSAAIEREFEELDAQNRWQQLYLEIRSESHDYPHRVAKFPENRNRNRYRDVSPYDHSRVK
LQNAENDYINASLVDIEEAQRSYILTQGPLPNTGCHFWLMVWQQKTKAVVMLNRIVEKDS
VKCAQYWPTKDDREMLFKETGFSVKFLSEDVKSYYTVHLLQLGNTRTGETRTISHFHYTT
WPDFGVPESPASFLNFLFKVRESGSLNPEHGPAVIHCSAGIGRSGTFSLVDSCLVLIEKG
DNINIKQLLLNMRKYRMGLIQTPDQLRFSYMTIIEGAKFIKGDSSIQKRWKELSKEDVCP
VFDHSPTKIMTEKYNGNRIGLEEEKLTGDRYSGLSSKTQEAPEESSESALRKRLREDRKA
STAQKVQQMKQRLSETERKRKRPRLTDT
Download sequence
Identical sequences A5D982
ENSBTAP00000013969 ENSBTAP00000013969 XP_010857345.1.44457 XP_019842368.1.53367 9913.ENSBTAP00000013969

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]