SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSBTAP00000014043 from Bos taurus 76_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSBTAP00000014043
Domain Number 1 Region: 216-279
Classification Level Classification E-value
Superfamily B-box zinc-binding domain 0.00000000000000183
Family B-box zinc-binding domain 0.0014
Further Details:      
 
Domain Number 2 Region: 541-612,648-737
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 0.000000000000211
Family SPRY domain 0.024
Further Details:      
 
Domain Number 3 Region: 425-529
Classification Level Classification E-value
Superfamily Fibronectin type III 0.000000000000885
Family Fibronectin type III 0.0038
Further Details:      
 
Domain Number 4 Region: 25-74
Classification Level Classification E-value
Superfamily RING/U-box 0.0000000000259
Family RING finger domain, C3HC4 0.035
Further Details:      
 
Weak hits

Sequence:  ENSBTAP00000014043
Domain Number - Region: 265-341
Classification Level Classification E-value
Superfamily Apolipoprotein A-I 0.034
Family Apolipoprotein A-I 0.019
Further Details:      
 
Domain Number - Region: 158-200
Classification Level Classification E-value
Superfamily FYVE/PHD zinc finger 0.0403
Family FYVE, a phosphatidylinositol-3-phosphate binding domain 0.055
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSBTAP00000014043   Gene: ENSBTAG00000010622   Transcript: ENSBTAT00000014043
Sequence length 759
Comment pep:known_by_projection chromosome:UMD3.1:3:15488474:15498217:-1 gene:ENSBTAG00000010622 transcript:ENSBTAT00000014043 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MAEGEDMQTFTSIMDALVRISTSMKNMEKELLCPVCQEMYKQPLVLPCTHNVCQACAREV
LGQQGYIGHGGDPSSEPTSPASTPSTRSPRLSRRTLPKPDRLDRLLKSGFGTYPGRKRGA
LHPQVIMFPCPACQGDVELGERGLAGLFRNLTLERVVERYRQSVSVGGAILCQLCKPPQL
EATKGCTECRATFCNECFKLFHPWGTQKAQHEPTLPTLSFRPKGLMCPDHKEEVTHYCKT
CQRLVCQLCRVRRTHSGHKITPVVSAYQALKDKLTKSLTYILGNQDTVQTQICELEETVR
HTEVSGQQAKEEVSQLVRGLGAVLEEKRASLLQAIEECQQERLARLSAQIQEHRSLLDGS
GLVGYAQEVLKETDQPCFVQAAKQLHNRIARATEALQTFRPAASSSFRHCQLDVGREMKL
LTELNFLRVPEAPVIDTQRTFAYDQIFLCWRLPPHSPPAWHYTIEFRRTDVPAQPGPTRW
QRREEVRGTSALLENPDTGSVYVLRVRGCNKAGYGEYSEDVHLHTPPAPVLHFFLDGRWG
TSRERLAISKDQRAVRSVPGLPLLLAAERLLTGCHLSVDVVLGDVAVTQGRSYWACAVDP
ASYLVKVGVGLESKLQESFQGAPDVISPRYDPDSGHDSGAEDATVEASPPFAFLTIGMGK
ILLGAGASANAGLTGRDGPAASCTVPLPPRLGICLDYERGRVSFLDAVSFRGLLECPLDC
SGPVCPAFCFIGGGAVQLQEPVGTKPERKVTIGGFAKLD
Download sequence
Identical sequences E1BBE9
9913.ENSBTAP00000014043 ENSBTAP00000014043 NP_001180056.1.59421 NP_001180056.1.76553 ENSBTAP00000014043

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]