SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSBTAP00000014109 from Bos taurus 76_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSBTAP00000014109
Domain Number 1 Region: 2-112
Classification Level Classification E-value
Superfamily Kringle-like 5.07e-21
Family Kringle modules 0.0012
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSBTAP00000014109   Gene: ENSBTAG00000010667   Transcript: ENSBTAT00000014109
Sequence length 261
Comment pep:known chromosome:UMD3.1:17:72198073:72208758:-1 gene:ENSBTAG00000010667 transcript:ENSBTAT00000014109 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MLLAWVRTILVSNMLLAEAYGSGGCFWDNGHLYRADQPSPAPGHSCLNWLDAQSGLAFAP
ESGAGNHSYCRNPDQDPRGPWCYVSGEAGAPEKRPCQDLRCPDTTSQGLPTSATETEEAA
EVPGGDEVFAPANALPARSEAAAVQPVIGISQRVRVNSKEKKDLGTLGYVLGITMMVIIV
VIGAGIVLGYTYKRGKDLKAQHEQKVCERELQRITLPLSAFTNPTCEIVDEKTVVVHASQ
TPVDLQEGSAPLMGQAGTPGA
Download sequence
Identical sequences Q1RMT9
ENSBTAP00000014109 ENSBTAP00000014109 NP_001069020.1.59421 NP_001069020.1.76553

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]