SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSBTAP00000014143 from Bos taurus 76_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSBTAP00000014143
Domain Number 1 Region: 607-906
Classification Level Classification E-value
Superfamily Protein kinase-like (PK-like) 1.48e-73
Family Protein kinases, catalytic subunit 0.000001
Further Details:      
 
Domain Number 2 Region: 29-187
Classification Level Classification E-value
Superfamily Galactose-binding domain-like 4.16e-41
Family Discoidin domain (FA58C, coagulation factor 5/8 C-terminal domain) 0.00035
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSBTAP00000014143   Gene: ENSBTAG00000010682   Transcript: ENSBTAT00000014143
Sequence length 915
Comment pep:known chromosome:UMD3.1:23:27975619:27989666:-1 gene:ENSBTAG00000010682 transcript:ENSBTAT00000014143 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MGPGALSFLLLLLLVATGDADMKGHFDPAKCRYALGMQDRTIPDGDISASSSWSDSTAAR
HSRLESSDGDGAWCPAGPVFPKEEEYLQVDLRRLHLVALVGTQGRHAGGLGKEFSPSYRL
RYSRDGHRWMDWRDRWGQEVILGNEDPGGVVLKDLGPPMVARLVRFYPRADRVMSVCLRV
ELYGCLWKGGAGTGERGVKDPLSCWEAVPMSEEGTEGPETHPIARLQYGGLGQLADGVVG
LDDFRKSQELRVWPGYDYVGWSNHSFPSGYVEMEFEFERLRAFQAMQVHCNNMHTLGARL
PGGVECRFKRGPAMAWEGEPVRHALGGSLGDPRARTVSVPLGGRMGRFLQCRFLFAGPWL
LFSEISFISDVVNDSSLALGGTFPPAPWWPPGPPPTNFSSLELEPRGQQPVAKAEGSPTA
ILIGCLVAIILLLLLIIALMLWRLHWRRLLSKAERRVLEEELTVHLSVPGDTILINNRPG
PREPPPYQEPRPRGNPPHSAPSVPNSSALLLSNPAYRLLLATYARPPRGPGPPTPAWAKP
TNTQACSGDYMEPEKPGAPLLPPPPQNSVPHYAEADIVTLQGVTGGNTYAVPALPPGAAG
DGPPRVDFPRSRLRFKEKLGEGQFGEVHLCEVESPQDLVSLDFPLSVRKGHPLLVAVKIL
RSDATKNARNDFLKEVKIMSRLKDPNIIRLLGVCVQDDPLCMITDYMENGDLNQFLSAHQ
LEDKATEGPGDGEAAQGPTISYPMLLHVAAQIASGMRYLATLNFVHRDLATRNCLVGENF
TIKIADFGMSRNLYAGDYYRVQGRAVLPIRWMAWECILMGKFTTASDVWAFGVTLWEVLM
LCRAQPFGQLTDEQVIENAGEFFRDQGRQVYLSRPPACPLSLYELMLRCWSREPEQRPPF
SQLHRFLAEDAVNTV
Download sequence
Identical sequences E1BBP4
ENSBTAP00000014143 ENSBTAP00000014143

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]