SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSBTAP00000014144 from Bos taurus 76_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSBTAP00000014144
Domain Number 1 Region: 35-128
Classification Level Classification E-value
Superfamily Immunoglobulin 6.71e-20
Family I set domains 0.0059
Further Details:      
 
Domain Number 2 Region: 140-185
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000000000637
Family EGF-type module 0.0058
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSBTAP00000014144   Gene: ENSBTAG00000010689   Transcript: ENSBTAT00000014144
Sequence length 644
Comment pep:known_by_projection chromosome:UMD3.1:7:52714639:52774754:-1 gene:ENSBTAG00000010689 transcript:ENSBTAT00000014144 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MSESKRRGRGRDPKHREGRKRERKQELLPGEEATRPKLKKMKSQTGQVGEKQSLKCEAAA
GNPLPSYRWFKDGKELNRSRDIRIKYGNGRKNSRLQFNKVKLEDAGEYVCEAENILGKDT
VRGRLFVNSVSTTLSSWSGHARKCNETAKSYCVNGGVCYYIEGINQLSCKCPVGYTGDRC
QQFAMVNFSKHLGFELKEAEELYQKRVLTITGICVALLVVGIVCVVAYCKTKKQRKQMHN
HLRQNMCPAHQNRSLANGPSHPRLDPEEIQMADYISKNVPATDHVIRRETETTFSGSHSC
SPSHHCSTATPTSSHRHESHTWSLDRSESLTSDSQSGIVLSSVGTSKCNSPACVEARARR
AAAYSLEERRRAAVPPYHDSIDSLRDSPHSERYVSALTTPARLSPVDFHYSLATQVPTFE
ITSPNSAHAVSLPPAAPINYRLAEQQPLLRQPAPPGPGPGPGPSADMQRSYDSYYKGPGP
RRGACALGGYRGSLPASPFRIPEDDEYETTQECAPPPPPRPRARGASRRTSAGPRRWRRS
RLNGLAAQRARAARDSLSLSSGSGGGSASASDDDADDADGALAAESTPFLGLRAAHDALR
SDSPPLCPAADSRTYYSLDSHSTRASSRHSRGPLPRGKQDSGPL
Download sequence
Identical sequences E1BBP3
ENSBTAP00000014144

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]