SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSBTAP00000014270 from Bos taurus 76_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSBTAP00000014270
Domain Number 1 Region: 123-303
Classification Level Classification E-value
Superfamily Galactose-binding domain-like 8.5e-42
Family CBM11 0.016
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSBTAP00000014270   Gene: ENSBTAG00000010778   Transcript: ENSBTAT00000014270
Sequence length 328
Comment pep:known chromosome:UMD3.1:10:36938124:36948842:-1 gene:ENSBTAG00000010778 transcript:ENSBTAT00000014270 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MALVHKLLNGTYILRKCPKPRVASFPFLGTRFADYCSNSFQKPVAAPGKASSQRKTKGNL
EEHHQREVALEITSPEDKPEISFDKAIKEEMKDHFRRLKDDIVKYWIGPEGRPLHEVLME
QAKVVWQFRSKEDLDKWTVTSDKVIGGRSEVFLKMGKNNQSALLYGTLSSEAPQDGESGR
SGYCAMVSKIPRGPFEMKRSYDWSQFNTLYLRVRGDGRPWMVNIREDTDIIQKKDQMYSY
FMFTRGGPYWQEVKIPFSKFFFSNQGRIRDAQYQLLLDKISSIGFTLADKVDGPFFLEID
FIGVFTDPAHTEEFAYENSPELNPRLFK
Download sequence
Identical sequences E1BAZ2
9913.ENSBTAP00000014270 ENSBTAP00000014270 NP_001193003.1.59421 NP_001193003.1.76553 ENSBTAP00000014270

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]