SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSBTAP00000014297 from Bos taurus 76_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSBTAP00000014297
Domain Number 1 Region: 27-130
Classification Level Classification E-value
Superfamily Spermadhesin, CUB domain 6.41e-26
Family Spermadhesin, CUB domain 0.000000706
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSBTAP00000014297   Gene: ENSBTAG00000010796   Transcript: ENSBTAT00000014297
Sequence length 134
Comment pep:known chromosome:UMD3.1:26:42871215:42877424:1 gene:ENSBTAG00000010796 transcript:ENSBTAT00000014297 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MKLSSVIPWALLLSTATVDSMDWLPRNTNCGGILKEESGVIATYYGPKTNCVWTIQMPPE
YHVRVSIQYLQLNCNKESLEIIDGLPGSPVLGKICEGSLMDYRSSGSIMTVKYIREPEHP
ASFYEVLYFQDPQG
Download sequence
Identical sequences G8JKX0 L8IL82
ENSBTAP00000014297 9913.ENSBTAP00000014297 ENSBTAP00000014297

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]