SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSBTAP00000014377 from Bos taurus 76_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSBTAP00000014377
Domain Number 1 Region: 194-345
Classification Level Classification E-value
Superfamily Growth factor receptor domain 0.00000000000000502
Family Growth factor receptor domain 0.01
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSBTAP00000014377   Gene: ENSBTAG00000010835   Transcript: ENSBTAT00000014377
Sequence length 420
Comment pep:known_by_projection chromosome:UMD3.1:22:16865105:16873234:-1 gene:ENSBTAG00000010835 transcript:ENSBTAT00000014377 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MAPRSSRGIAPAMLCGLSLFLGFPGLVWVQISVPPQSSPHTEPHPCHTCRGLVDSFNKGL
ERTIRDNFGGGNTAWEEEKLSKYKDSETRLVEVLEGVCSKSDFECHRLLELSEELVESWW
FHKQQEAPDLFQWLCSDSLKLCCPSGTFGPSCLPCPGGAERPCGGYGHCEGEGTRGGSGH
CDCQAGYGGEACGQCGLGYFEAERNASHLVCSACFGPCARCSGPEESHCLQCKKGWALHH
LKCVDIDECGTERASCGADQFCVNTEGSYECRDCAKACLGCMGAGPGRCKKCSPGYQQVG
SKCLDVDECETAVCPGENQQCENTEGSYRCICADGYKQMEGICVKEQIPESAGFFSEMTE
DELVVLQQMFFGVIICALATLAAKGDLVFTAIFIGAVAAMTGYWLSERSDRVLEGFIKGR
Download sequence
Identical sequences F1N3P8 L8HYD5
NP_001014851.3.59421 NP_001014851.3.76553 XP_005907124.1.15283 XP_019840326.1.53367 9913.ENSBTAP00000014377 ENSBTAP00000014377 ENSBTAP00000014377

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]