SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSBTAP00000014410 from Bos taurus 76_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSBTAP00000014410
Domain Number 1 Region: 395-532
Classification Level Classification E-value
Superfamily CalX-like 1.7e-31
Family CalX-beta domain 0.00000851
Further Details:      
 
Domain Number 2 Region: 524-675
Classification Level Classification E-value
Superfamily CalX-like 6.8e-28
Family CalX-beta domain 0.0000028
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSBTAP00000014410   Gene: ENSBTAG00000010856   Transcript: ENSBTAT00000014410
Sequence length 922
Comment pep:known_by_projection chromosome:UMD3.1:18:54853503:54881796:-1 gene:ENSBTAG00000010856 transcript:ENSBTAT00000014410 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MAPLALVGFALLLGTPPCSGAATPTPSLPPPPANDSDASSTGGCQGSNRCQPGVLLPVWE
PDDPSLGDKAARAVVYFVAMVYMFLGVSIIADRFMASIEVITSKEKEITITKANGETSVG
TVRIWNETVSNLTLMALGSSAPEILLSVIEVCGHNFQAGELGPGTIVGSAAFNMFVVIAV
CIYVIPAGESRKIKHLRVFFVTASWSIFAYVWLYLILAVFSPGVVQVWEALLTLVFFPVC
VVFAWMADKRLLFYKYVYKRYRTDPRSGIIIGAEGDPPKSIELDGTFVGAEAPGEVGGLG
PGPAEARELDASRREVIQILKDLKQKHPDKELEQLVGIANYYALLHQQKSRAFYRIQATR
LMTGAGNVLRRHAVDASRRATPADGPGEDEDDGASRIFFEPSLYHCLENCGSVLLSVTCQ
GGEGNSTFYVDYRTEDGSAKAGSDYEYSEGTLVFKPGETLKELRIGIIDDDIFEEDEHFF
VRLLNLRVGDAQGMFEPDGGGRPKGRLVSPLLATVTILDDDHAGIFSFQDRLLHVSECMG
TVDVRVVRSSGARGTVRLPYRTVDGTARGGGVHYEDACGELEFGDDETMKTLQVKIVDDE
EYEKKDNFFIELGQPQWLKRGISALLLNQGDGDRKLTAEEEEAQRIAEMGKPVLGENCRL
EVIIEESYDFKNTVDKLIKKTNLALVIGTHSWREQFLEAITVSAGDEEEEEDGSREERLP
SCFDYVMHFLTVFWKVLFACVPPTEYCHGWACFGVCILVIGLLTALIGDLASHFGCTVGL
KDSVNAVVFVALGTSIPDTFASKVAALQDQCADASIGNVTGSNAVNVFLGLGVAWSVAAV
YWAVQGRPFEVRTGTLAFSVTLFTVFAFVGIAVLLYRRRPHIGGELGGPRGPKLATTALF
LGLWFLYILFASLEAYCHIRGF
Download sequence
Identical sequences E1B7D0
XP_002695230.2.76553 XP_615995.7.59421 ENSBTAP00000014410 ENSBTAP00000014410

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]