SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSBTAP00000014522 from Bos taurus 76_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSBTAP00000014522
Domain Number 1 Region: 225-409
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 2.97e-39
Family Pentraxin (pentaxin) 0.00071
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSBTAP00000014522   Gene: ENSBTAG00000000109   Transcript: ENSBTAT00000014522
Sequence length 422
Comment pep:known_by_projection chromosome:UMD3.1:5:110939444:110956819:-1 gene:ENSBTAG00000000109 transcript:ENSBTAT00000014522 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
APAASAHPLPPVPLFSRFLCTPLAAACPSGAEPGDAAPGEREELLLLQSTAEQLRQTALQ
QEARIRADQDTIRELTGKLGRCESGLPRGLQEAGPRRDTMADGPWDSPALILELEDAVRA
LRDRIDRIEQQELPARVNFSAAPAPAPVVPTALHSKMDELEGQLLAKVLALEKERMALGH
SSQQQRQEVEKELDALQDRVAELEHGSSAYSPPDAFKISIPIRNNYMYARVRKALPELYA
FTVCMWLRSRSGGTGQGTPFSYSVPGQANEIVLLEAGHDPMELLINDKVAQLPLSLKDNG
WHHICIAWTTRDGLWSAYQDGELRGSGENLAAWHPIKPHGILILGQEQDTLGGRFDATQA
FVGDIAQFNLWDHALTPAQVLGIANCTGPLLGNILPWEDKLVEAFGGATKAAFDVCKGRA
KA
Download sequence
Identical sequences F1N1R9
ENSBTAP00000014522 ENSBTAP00000014522

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]