SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSBTAP00000014533 from Bos taurus 76_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSBTAP00000014533
Domain Number 1 Region: 106-282
Classification Level Classification E-value
Superfamily L domain-like 2.15e-34
Family Internalin LRR domain 0.042
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSBTAP00000014533   Gene: ENSBTAG00000010944   Transcript: ENSBTAT00000014533
Sequence length 685
Comment pep:known chromosome:UMD3.1:10:17722005:17875574:1 gene:ENSBTAG00000010944 transcript:ENSBTAT00000014533 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MIPGKYRSVSGRAASNVNCGLHLVIQTSSLPEKNKVEFKLNRETPSFPGRLLQHDLERNY
SSRQGDHINLVSSSMPSFPILQRSSEEKILYSDRLTLERQKLTVCPIIDGEEHLRLLNFQ
HNSITQIQNISNLQRLIFLDLYDNQIEEISGLSTLRSLRVLLLGKNRIKKISNLENLKSL
DVLDLHGNQITKIENVNHLCDLRVLNLARNFLSHVDNLNGLDSLTELNLRHNQITFVRDV
DNLPCLQRLFLSFNNISTFESVCCLADSTSLSDITFDGNPIAQESWYKHTILQNMMQLRQ
LDMKRITEEERRMASVVAKKEEEKKRESQKQSLLKEKKRLTINNVARKWDLQQHRITSIA
INQDRRDSDSQDHCQNDGSTVSTFPEEAGSLDSGLTSALQDLSVTDTHLVEVDGDTLSLY
GSGALECLDRNWSVQTAGMVTTVSFTFIEFDEIVQVLPKLKIKFPNSLHLKFKETNLVML
QQFNALAQLRRVDQLTIDPQGNPVVNFTLWKYYVLFRLSHFNMQKINGTEVTQNDMIMAE
RLFGILAHVASSELPQYRLISILGDARKKQFRYLLETKGKKPGIVSEENNDSKRLVGENT
NRATLNYTTRDFYTEKLEEIKEKKKFCKMYIEDLVKEATEINMKNEALQKLWPQMFIELV
RDAVIEIRNKNSYMKLCLQQITDQK
Download sequence
Identical sequences A6QQZ2
ENSBTAP00000014533 9913.ENSBTAP00000014533 ENSBTAP00000014533 NP_001093813.1.59421 NP_001093813.1.76553 XP_010832780.1.44457

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]