SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSBTAP00000014881 from Bos taurus 76_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSBTAP00000014881
Domain Number 1 Region: 21-227
Classification Level Classification E-value
Superfamily L domain-like 1.42e-25
Family Internalin LRR domain 0.0018
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSBTAP00000014881   Gene: ENSBTAG00000011205   Transcript: ENSBTAT00000014881
Sequence length 359
Comment pep:known_by_projection chromosome:UMD3.1:14:33149806:33194416:-1 gene:ENSBTAG00000011205 transcript:ENSBTAT00000014881 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MVRLTLDLIAKNSNLKPRKEENVLQYLKKITHINFSDKNIDAIEDLSLCKNLSVLYLYDN
RISQITNLNYATNLTHLYLQNNCISCIENLRSLKKLEKLYLGGNYIAVIEGLEGLEGLRE
LHVESQRLPLGEKLVFDPRTLHSLAKSLSILNISNNNIDDIRDLEILENLNQLIAADNQL
LHVKDLEFLLNKLMKLWKMDLNRNPVCLKPKYRDRLILVSKSLEFLDGKEIKNMERQFLM
NWKASKDAKKTSKKKNSKNEDTHNSCNSNFETMHHIVPVYYPKVGKPKLVFFSDIQRFLA
NGNAAPESSQEGNSKIIDDMGTLSLKTSESLLTKNDVREPHLLHNLQSLIKKNLCNSCL
Download sequence
Identical sequences E1BN26
ENSBTAP00000044218 ENSBTAP00000014881

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]