SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSBTAP00000014927 from Bos taurus 76_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSBTAP00000014927
Domain Number 1 Region: 4-358
Classification Level Classification E-value
Superfamily Glyoxalase/Bleomycin resistance protein/Dihydroxybiphenyl dioxygenase 3.54e-51
Family Extradiol dioxygenases 0.00051
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSBTAP00000014927   Gene: ENSBTAG00000011241   Transcript: ENSBTAT00000014927
Sequence length 390
Comment pep:known chromosome:UMD3.1:3:101333430:101335081:-1 gene:ENSBTAG00000011241 transcript:ENSBTAT00000014927 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MAAPVRRLCHIAFHVPAGLPLARDLQRLFGFQPLAVREADGWRQLALRSGDAVFLVNEGA
GPGEPLYGLDPHHGIPSATNLCFDVADAGAAARGLAALGCSVPVPPVSVRDEQGTATYAV
VSSPAGNLSLTLLERTGFGGPFLPGFSPVPSTPGPGWFSHVDHLTLACNPSSSPKLLHWF
HDCLGFHHLPLSPGEDPELGLEVAAGSGLGGLRLTALQGPVGSAVPTLVLAESLPRATSG
QDQVEQFLARNRGPGLQHVGLYTPSIKEATEGVAGAGGQLLTPPKAYYQQPGKEEQILAA
GQEPNLLARQGVLLDGDRGKFLLQVFTKSLFAEDTFFLELIQRQGATGFGQGNIRALWQS
VQEQAARVQEACKGPKLDAAGCPGALESSA
Download sequence
Identical sequences A5PJL0
9913.ENSBTAP00000014927 NP_001092841.1.59421 NP_001092841.1.76553 ENSBTAP00000014927 ENSBTAP00000014927

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]