SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSBTAP00000014977 from Bos taurus 76_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSBTAP00000014977
Domain Number 1 Region: 70-308
Classification Level Classification E-value
Superfamily L domain-like 1e-33
Family Internalin LRR domain 0.0074
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSBTAP00000014977   Gene: ENSBTAG00000011273   Transcript: ENSBTAT00000014977
Sequence length 342
Comment pep:known chromosome:UMD3.1:5:103908372:103915853:-1 gene:ENSBTAG00000011273 transcript:ENSBTAT00000014977 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MSDEDDLEDFETDQDDLEREDDEKETEEWEDYRKEGEESEDWISTPLTEDMMKEGLSLLC
KTGNGLAHAYVKLEIKDRDLTDIHLLRSYIHLRYVDVSENHLTDLSPLNHLTHLLWLKAD
GNQLRSARLNELPYLQIASFAYNQITDTEGISHPRLASLDLKGNRIHMVTGLDPQKLISL
HTLELRGNQLNSTLGINLPKLKNLFLAQNMLKKVEGLENLSNLTTLHLRDNQIETLSGFS
KEMKSLQYLNLRGNMVADLGELAKLRDLPRLRALVLLDNPCTDENDYRQEALVQIAHLER
LDKEFYEEEERAEADEIRQRMKEEQEQEAEVEPESELDQSST
Download sequence
Identical sequences F1N124
ENSBTAP00000014977 ENSBTAP00000014977 XP_005907549.1.15283 XP_014337564.1.15283 XP_019815809.1.53367

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]