SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSBTAP00000014986 from Bos taurus 76_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSBTAP00000014986
Domain Number 1 Region: 303-529
Classification Level Classification E-value
Superfamily vWA-like 2.97e-60
Family Integrin A (or I) domain 0.00029
Further Details:      
 
Domain Number 2 Region: 9-217
Classification Level Classification E-value
Superfamily vWA-like 9.32e-56
Family Integrin A (or I) domain 0.00029
Further Details:      
 
Domain Number 3 Region: 221-266
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000000000099
Family EGF-type module 0.017
Further Details:      
 
Domain Number 4 Region: 256-310
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000000142
Family EGF-type module 0.018
Further Details:      
 
Domain Number 5 Region: 539-580
Classification Level Classification E-value
Superfamily Chicken cartilage matrix protein 0.00000301
Family Chicken cartilage matrix protein 0.0031
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSBTAP00000014986   Gene: ENSBTAG00000011279   Transcript: ENSBTAT00000014986
Sequence length 584
Comment pep:known_by_projection chromosome:UMD3.1:13:74358170:74372227:-1 gene:ENSBTAG00000011279 transcript:ENSBTAT00000014986 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MRGLLYSLLPLLLLLLQPWETQLQLAGPRCSSGPLDLVFVIDSSRSVRPFEFETMRQFLV
GLLRSLDVGPNATRVGVIQYSSQVQSVFPLRAFSRREDMERAIRAVVPLAQGTMTGLAIQ
YAMNVAFSVAEGARPPEAHVPRVAVIVTDGRPQDRVAEVAAQARARGIEIYAVGVQRADV
GSLRAMASPPLNEHVFLVESFDLIQEFGRQFQGRLCTLDLCTEGDHGCEHQCVSMPGSYF
CRCQAGFVLQQEQRSCRAIDHCSFGNHSCQHDCVSIYGGPQCRCREGYDLLPDGRSCQAR
DLCNGVDHGCEFQCVSEGFSYRCVCPEGRQLQADGKSCSRCREGHVDLVLLVDGSKSVRP
QNFELVKRFVNQIVDFLDVSPEGTRVGLVQFSSRVRTEFPLGRYGTAAEVKQAVLAVEYM
ERGTMTGLALRHMVEHSFSEAQGARPRALNVPRVGLVFTDGRSQDNISVWAARAKEEGIV
MYAVGVGKAVEEELREIASEPAELHVSYSPDFSTMTHLLENLKGSICPEEGIGAGTELRS
PCECESLVEFQGRTLGALESFLNLPLAQLTARLEDLENQLATQK
Download sequence
Identical sequences E1BDF3
ENSBTAP00000014986 ENSBTAP00000014986

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]