SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSBTAP00000015014 from Bos taurus 76_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSBTAP00000015014
Domain Number 1 Region: 24-141
Classification Level Classification E-value
Superfamily Spermadhesin, CUB domain 2.22e-29
Family Spermadhesin, CUB domain 0.0000989
Further Details:      
 
Domain Number 2 Region: 192-304
Classification Level Classification E-value
Superfamily Spermadhesin, CUB domain 4.97e-28
Family Spermadhesin, CUB domain 0.0000338
Further Details:      
 
Domain Number 3 Region: 141-191
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000000000174
Family EGF-type module 0.0009
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSBTAP00000015014   Gene: ENSBTAG00000008612   Transcript: ENSBTAT00000015014
Sequence length 394
Comment pep:known chromosome:UMD3.1:5:103737161:103747960:1 gene:ENSBTAG00000008612 transcript:ENSBTAT00000015014 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MWLLYLLLPVLFYRVGGATPTPQKLYGEVMSPLFPKPYPNNFERTTVITVPTGYKVKLVF
WQFDLEPSEGCLYDYVKISADKKTMGRFCGQLGSPLSNPPGRKEFMSQGNKMLLTFHSDF
SNEENGTIMFYKGFLAYYQAVDVDECALQLNSVEEDPPAGCQHLCHNYVGGYFCSCRPGY
ELQPDGRSCQAECSSELFTEPSGYISSLEYPRPYPPDLRCNYSIRVERGHTLHLQFLEPF
EIDDHQQIHCPYDQLQVYVSGRNIGEFCGKQRPERIDAQSNSVDLLFFTDESGDSRGWKL
YYTSEVIKCPQPKTLDSFTIIQDLQPQYQYRDYFIATCKKATSLWRGTRHSCPSQLSARM
MAHGTVPCPGAGSRTAGSPEACSTGPSITPPERG
Download sequence
Identical sequences Q3SYT3
ENSBTAP00000015014 NP_001029579.1.59421 NP_001029579.1.76553

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]