SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSBTAP00000015061 from Bos taurus 76_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSBTAP00000015061
Domain Number 1 Region: 312-490
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 3.96e-65
Family SPRY domain 0.0000043
Further Details:      
 
Domain Number 2 Region: 7-84
Classification Level Classification E-value
Superfamily RING/U-box 2.83e-23
Family RING finger domain, C3HC4 0.0048
Further Details:      
 
Domain Number 3 Region: 91-153
Classification Level Classification E-value
Superfamily B-box zinc-binding domain 9.46e-16
Family B-box zinc-binding domain 0.0016
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSBTAP00000015061   Gene: ENSBTAG00000011332   Transcript: ENSBTAT00000015061
Sequence length 495
Comment pep:known chromosome:UMD3.1:15:51035535:51047873:1 gene:ENSBTAG00000011332 transcript:ENSBTAT00000015061 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MDPATLMEAVVEEVACPICMTFLKEPVSIDCGHSFCHSCLLGLWEVPGESQNWAYSCPLC
RAPIEPRNLRPNWQLANVVEKVRRLGLHPGMGLRADMCEPHREQLKMFCKEDGLIVCEAC
SRSPEHQAHSVVPMEDVAWDYKWKLHEALEHLKKEQEEAWKLEVGERKRTANWKIQVETR
KQSIIWEFEKYRRLLKKKQPPALASLQQEERETMQKLELNHEALIQQSRVLWRMIAELEE
RSQRPVRWMLQGIQEVLNRSNSWSLQRPEPVSLELKTDCRVLGLREILKTYAEMSPKPPH
SVSGYQPRPFSSADVRLDPDTAYSRLIVSEDRKCVRYGDTKQKLPDNPERFYRYNIVLGS
QCISSGRHYWEVEVGDRSEWGLGVCKENVDRKEVVFLSPHYGFWVIRLRKGNEYRAGTDE
YPLLSLPVPPRRVGVFLDYEAHDISFYNVTDNGSHIFTFPHYPFPGRLLPYFSPCYSIGA
NNTAPLAICSLDGED
Download sequence
Identical sequences E1BQ22
ENSBTAP00000015061 ENSBTAP00000015061

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]