SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSBTAP00000015166 from Bos taurus 76_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSBTAP00000015166
Domain Number 1 Region: 785-835
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000000000642
Family Laminin-type module 0.0086
Further Details:      
 
Domain Number 2 Region: 347-399
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000000000335
Family Laminin-type module 0.046
Further Details:      
 
Domain Number 3 Region: 879-931
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000000000446
Family Laminin-type module 0.0036
Further Details:      
 
Domain Number 4 Region: 833-881
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000000000558
Family Laminin-type module 0.0071
Further Details:      
 
Domain Number 5 Region: 940-990
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000000586
Family Laminin-type module 0.068
Further Details:      
 
Domain Number 6 Region: 283-349
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000000712
Family Laminin-type module 0.037
Further Details:      
 
Domain Number 7 Region: 988-1039
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000000103
Family Laminin-type module 0.0035
Further Details:      
 
Domain Number 8 Region: 522-563
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000000558
Family Laminin-type module 0.012
Further Details:      
 
Domain Number 9 Region: 470-514
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000000642
Family Laminin-type module 0.0082
Further Details:      
 
Domain Number 10 Region: 1096-1138
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000000949
Family Laminin-type module 0.022
Further Details:      
 
Domain Number 11 Region: 1040-1093
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000781
Family Laminin-type module 0.0027
Further Details:      
 
Domain Number 12 Region: 1144-1191
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000977
Family Laminin-type module 0.017
Further Details:      
 
Domain Number 13 Region: 431-472
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000112
Family Laminin-type module 0.026
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSBTAP00000015166   Gene: ENSBTAG00000011412   Transcript: ENSBTAT00000015166
Sequence length 1798
Comment pep:known chromosome:UMD3.1:4:49263419:49339822:-1 gene:ENSBTAG00000011412 transcript:ENSBTAT00000015166 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
SVAVSPGLQGLDMGRLQVFAFSFLALCGVGVSAQEPDFSYGCAEGSCYPATGDLLIGRAQ
KLSVTSTCGLHKPEPYCIVSHLQEDKKCFICNSQDPYHETLNPDSHLIENVVTTFAPNRL
KIWWQSENGVENVTIQLDLEAEFHFTHLIMTFKTFRPAAMLIERSSDFGKTWGVYRYFAY
DCESSFPGISTGPMKKVDDIICDSRYSDIEPSTEGEVIFRALDPAFRIEDPYSPRIQNLL
KITNLRIKFVKLHTLGDNLLDSRMEIREKYYYAVYDMVVRGNCFCYGHASECAPVDGVNE
EVEGMVHGHCMCRHNTKGLNCEQCMDFYHDLPWRPAEGRNSNACKKCNCNEHSSSCHFDM
AVYLATGNVSGGVCDDCQHNTMGRNCEQCKPFYYQHPERDIRDPSLCEQCTCDPAGSQNG
GICDSYTDFSAGLIAGQCRCKLYVEGEHCDICKEGFYGLSAEDPFGCKSCACNPLGTIPG
GNPCDSETGYCYCKRLVTGQHCDQCLPEHWGLSNDLDGCRPCDCDIGGALNNSCSAESGQ
CLCRPHMIGRQCSEVESGYYFTTLDHYIYEAEEANFGPGVSIVERQYIQDRIPSWTGAGF
VRVPEGAYLEFFIDNIPYSMEYDILIRYEPQLPDHWEKAVIMVQRPGKIPTSSRCGNTVP
DDDNQVVSLSPGSRYVVLPRPVCFEKGVNYTVRLELPQYTSSDSGVDSPYTLIDSLVLMP
FCKSLDIFTVGGSGDGVVTNSAWETFQRYRCLENSRSVVKTPMTDVCRNIIFSISALLHQ
TGLACECDPQGSLSSVCDPNGGQCQCRPNVVGRRCDRCAPGTFGFGPSGCKPCECHLQGS
VSAFCDPITGQCHCFQGVYTRQCDRCLPGFWGFPSCQPCQCNGHADDCDSVTGECLSCQD
YTTGHNCERCLAGYYGDPVIGSGDHCRPCPCPDGPESGRQFASSCYQDPVSLQLACVCNP
GYIGSRCDECASGFFGNPSDVGGTCQPCQCHHNIDTADPEACDKETGRCLKCLYHTEGEH
CQLCRFGYYGDALRQDCRKCVCNYLGTVQEHCNGSDCQCDKTTGQCLCLPNVIGQNCDRC
APNTWQLASGTGCDPCSCDAAHSFGPSCNEFTGQCHCMPGFGGRTCSECQELFWGDPSVE
CRACDCDPRGIETPQCDQSTGQCVCVEGVEGPRCDKCTRGYSGVFPDCTPCHQCFALWDV
IIAELTNRTQKFLEKAKALKISGVIGPYRETVDSVEKKVNEIRDILAQSPAAEPLKNIGN
LFEEAEKLTKDVTEKMAQVQVGPSPRKAKSRCLASSRATVRCQWDKVYSLIMRRKLYFFK
AISSHALGALDSITKYFQMSLEAEERVNASTTSSNSTVEESALTRDRVEDFILERESQFR
EKQEEQARLLDELAGKLQSLDLSAAAEMTCGTPPGASCSETECGGPNCRTDEGEKKCGGP
GCGGLVTVAHSAWQKAMDFDRDVLSALAEVEQLSKMVSEAKLRADEAKQNAQDVLLKTNA
TKEKVDRSNEDLRNLIKQIRNFLTQDSADLDSIEAVANEVLKMEMPSTPQQLQNLTEDIR
ERVESLSQVEVILQQSAADIARAEILLEEAQKASKSATDVKVTADMVREALEEAEKAQIA
AEKAIKQADEDIQGTQNLLTSIESETAASEETLFNASQRISELERNVEELKRKAAQNSGE
AEYIEKVVYTVKQSAEDVKKTLDNELDEKYKKVENLIAKKTEESADARRKAEMLQNEAKT
LLAQANSKLQLLKDLERKYEDNQKYLEDKAQELVRLEGEVRSLLKDISQKVAVYSTCL
Download sequence
Identical sequences F1MNT4
ENSBTAP00000015166 ENSBTAP00000015166

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]