SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSBTAP00000015174 from Bos taurus 76_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSBTAP00000015174
Domain Number 1 Region: 128-378
Classification Level Classification E-value
Superfamily Carbonic anhydrase 1.7e-80
Family Carbonic anhydrase 0.000000912
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSBTAP00000015174   Gene: ENSBTAG00000011420   Transcript: ENSBTAT00000015174
Sequence length 449
Comment pep:known_by_projection chromosome:UMD3.1:8:60260367:60266465:1 gene:ENSBTAG00000011420 transcript:ENSBTAT00000015174 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MAPLCPSPRLPLWIPAPAPGPAVQLLLLLLLLVPAHPQKLLWMQGAPTTGGDSSGEDDPL
GEEDLPSEEDIPEEEDSPEEEDLPGLKTDPGEENSLKLEDLPTVEAPRDTEGPQNNAHRD
EKGDGHSHWRYGGAPPWPQVSPACAGRFQSPVDIRPELTAFCPALRPLEFLGFELPPQPK
LRLCNNGHTVQLSLPSGLKMALGPGQEYRALQLHLHWGAAGRPGSEHTVDGHRFPAEIHV
VHLSTAFEEFDEALGRPGGLAVLAAFLQEGPEENSAYEQLLSRLGEITEKDSETWVPGLD
VSALLPSDLSRYFRYEGSLTTPPCAQGVIWTVFNQTVKLSAKQLHTLSDSLWGPDDSRLQ
LNFRATQPLNGRIIEASFPAGVDGSPRTVEPVHLNSCLAAGDILALVFGLLFAVTSIAFL
VQMRRQQRHLSETKGSVSYHPAEVTETVA
Download sequence
Identical sequences E1BPA4 L8IB91
ENSBTAP00000015174 9913.ENSBTAP00000015174 ENSBTAP00000015174 XP_005900831.1.15283

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]