SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSBTAP00000015204 from Bos taurus 76_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSBTAP00000015204
Domain Number 1 Region: 24-441
Classification Level Classification E-value
Superfamily Periplasmic binding protein-like I 1.35e-98
Family L-arabinose binding protein-like 0.0000000113
Further Details:      
 
Domain Number 2 Region: 533-628
Classification Level Classification E-value
Superfamily Protein kinase-like (PK-like) 3.22e-16
Family Protein kinases, catalytic subunit 0.0073
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSBTAP00000015204   Gene: ENSBTAG00000011434   Transcript: ENSBTAT00000015204
Sequence length 629
Comment pep:known chromosome:UMD3.1:8:60368097:60379016:-1 gene:ENSBTAG00000011434 transcript:ENSBTAT00000015204 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MALPSLLLVVAALAGGVRPPGARNLTLAVVLPEHNLSYAWAWPRVGPAVALAMEALGRAL
PVDLRFVSSELDGACSEYLAPLRAVDLKLYHDPDLLLGPGCVYPAASVARFASHWRLPLL
TAGAVASGFSAKSEHYRTLVRTGPSAPKLGEFVVMLHGHFNWTARAALLYLDARTDDRPH
YFTIEGVFEALQGSNLSVQHQVYAREPGGPEQATHFIRANGRIVYICGPLEMLHEILLQA
QRENLTNGDYVFFYLDVFGESLRAGPTRSMGRPWQDNRTREQAQALREAFQTVLVITYRE
PPNPEYQEFQNRLLIRAREDFGVELAPSLMNLIAGCFYDGILLYAEVLNETIQEGGTRED
GLRIVEKMQGRRYRGVTGLVVMDKNNDRETDFVLWAMGDLVSGDFQPAAHYSGAEKQIWW
TGRPIPWVKGVPPLDNPPCAFDMDDPSCDKTPLSTLAIVALGTGITFIMFGVSSFLIFRK
LMLEKELASMLWRIRWEELQFGNSERCHKGAGSRLTLSLRGSSYGSLMTAHGKYQIFANT
GHFKGNVVAIKHVNKKRIELTRQVLFELKHMRDVQFNHLTRFIGACIDPPNICIVTEYCP
RGSLQDILENDSINLDWMFRYSLINDLVK
Download sequence
Identical sequences G3X6W7
ENSBTAP00000015204 ENSBTAP00000015204

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]