SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSBTAP00000015212 from Bos taurus 76_3.1

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  ENSBTAP00000015212
Domain Number - Region: 456-497
Classification Level Classification E-value
Superfamily EGF/Laminin 0.023
Family EGF-type module 0.097
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSBTAP00000015212   Gene: ENSBTAG00000011445   Transcript: ENSBTAT00000015212
Sequence length 744
Comment pep:known chromosome:UMD3.1:8:60420015:60439343:1 gene:ENSBTAG00000011445 transcript:ENSBTAT00000015212 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
SPRKLSPFRSFASTELFHFHVPEDTFLAVWNLIIFKEQGGTFGDHCPDQSVTVYFRSGAP
PVINPLHTHFPGDTAVPGVFSLTLSWTLPNRTSGIFNVSSPLPGDWFLAAHLPQAHGHIS
VKGLQDECQYLLQPQLIVRRLLDVAVLVPGRPSEQTLSAHNRSALYKVFVPSFTYRVSAQ
LVCVGGRGASACPLTLRLRPKAPPLHNSSSVACGGASVCQLELALPPWGHWVYVRVETPS
RGPGRTIRFQLCVWLQECPQPSLSRAVVPGAAMNMPQSLGNQPLPPEPPSLRTPAEGPGA
TSPPEHCWPVRPTLRNELDTFSVHFYIFFGPSVALPPERPAVFALRLLPVLDSGGVLSLE
LQLNVSSLRQENVTVFGCLTHEVPLSLGDAAVTCSKESLAGFLLTVSAASRVARLRIPFP
QTGTWFLTLRSLCGVGPRFVRCRNATAEVRLRTFLSPCVDDCGPYGQCKLLRTHNYLYAA
CECKAGWRGWGCTDSADALTYGFQLLSTLLLCLSNLMFLPPVVLAIRSRYVLEAAVYTFT
MFFSTFYHACDQPGIVVFCIMDYDVLQFCDFLGSLMSVWVTVIAMARLQPVVKQVLYLLG
AMLLSMALQLDRHGLWNLLGPSLFALGILATAWTVRSVRRRHCYPPTWRRWLFCLCPGSL
IAGSAILLYAFVETRDNYFYIHSIWHMLIAGSVGFLLPPRAKTDRRVPSGARARGCGYQL
CINEQEELGLVGPGGATVSSICAS
Download sequence
Identical sequences F1MLC4
ENSBTAP00000015212 9913.ENSBTAP00000015212 ENSBTAP00000015212

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]