SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSBTAP00000015261 from Bos taurus 76_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSBTAP00000015261
Domain Number 1 Region: 288-416
Classification Level Classification E-value
Superfamily Growth factor receptor domain 0.00000523
Family Growth factor receptor domain 0.0048
Further Details:      
 
Weak hits

Sequence:  ENSBTAP00000015261
Domain Number - Region: 174-203
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0385
Family Laminin-type module 0.049
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSBTAP00000015261   Gene: ENSBTAG00000011483   Transcript: ENSBTAT00000015261
Sequence length 841
Comment pep:known_by_projection chromosome:UMD3.1:19:23309862:23319829:-1 gene:ENSBTAG00000011483 transcript:ENSBTAT00000015261 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
TDPSPPAALAAMGPGLLFPLLLLEALGAPGSELDAGGRHVCKASSPSAELQCCPGWRRKD
RECTIPICEGLDACREDEVCVKPGLCRCKPGFFGAQCNSRCPGQYWGPDCREVCACHPHG
QCEPATGVCHCQPDRWGDRCEFPCACGPHGRCNPETGACRCEPGWWSPTCRRPCQCNPAA
ARCDQATGSCLCEPGWWGRRCSFRCACHGSPCAQESGRCACRPGWWGPECRQPCECVRGR
CSAVSGQCSCPPGFQGVRCELPCPAGQYGLRCRDSCGHCKQNKPCSADTGSCEACKPGWN
GTQCHQPCPPGTFGENCSQQCPHCRLGEACQPDTGHCQRCEPGWRGPRCEDPCLIGTFGE
GCGSTCPTCVQGACDAVTGECVCNAGYWGPSCNTSCPSGFHGNNCSVPCECPEGNCDPVS
GACQLGSHSQDAALIAGILVPLLLLLLAIACCACCCWAARLDPKDRPVRDGTAMSRMKLR
VWGALTSSLGSALPCGPLSSHKLPWVTVSHHDPEIPFNHSFIEPPSAGWASDDSFSSDSE
SGEEDEGPAYCVPPQEGMVPAVPAESSEASLAGGPFPPPEDASTPFAIPRTSSLARAKRP
SVSFAEGTKFAPQSRRGSGELSSPLRKPKRLSRGTQPGPESQETEESTGPQVETDGAPPG
TASPRDSAVGRRRLPLGGRTVAERVEAIEGSVQESSGSVTTIYMLAGTPRGPEGPVRSVL
RRFGSFQKGQAEPKVKSAIPKPPRRALSRNKDSPRLDSGSANQSPSSAMKEELTGALESS
GTGSEEGARSLGGSIKSSEGGQELAPEDGSLVQDPQKVADKEGQEEPQYENVVPISGPLE
P
Download sequence
Identical sequences F1ML32
ENSBTAP00000015261 9913.ENSBTAP00000015261 ENSBTAP00000015261

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]