SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSBTAP00000015268 from Bos taurus 76_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSBTAP00000015268
Domain Number 1 Region: 179-278
Classification Level Classification E-value
Superfamily Immunoglobulin 4.05e-21
Family I set domains 0.012
Further Details:      
 
Domain Number 2 Region: 60-147
Classification Level Classification E-value
Superfamily Growth factor receptor domain 0.0000000000000251
Family Growth factor receptor domain 0.0021
Further Details:      
 
Domain Number 3 Region: 132-177
Classification Level Classification E-value
Superfamily Kazal-type serine protease inhibitors 0.000000000785
Family Ovomucoid domain III-like 0.009
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSBTAP00000015268   Gene: ENSBTAG00000011489   Transcript: ENSBTAT00000015268
Sequence length 312
Comment pep:known_by_projection chromosome:UMD3.1:26:21760437:21762788:1 gene:ENSBTAG00000011489 transcript:ENSBTAT00000015268 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
SALGFQLIMPQPPAAALALPVLLLLLLLVVRTPPPTGARPSPGPDYLRRGWLRLLAEGEG
CAPCRPEECAAPRGCLAGRVRDACGCCWECANLEGQLCDLDPSAHFYGRCGEQLECRLDA
GGDLSRGEVPEPLCVCRSQRPLCGSDGRTYAQICRLQEAARARPDANLTVAHPGPCETAP
QILLHPYDVWNVTGQDVIFGCEVFAYPMASIEWRKDGLDIQLPGDDPHISVQFRGGPQRF
EVTGWLQIQAVRPSDEGTYRCLARNALGQVEAPASLTVLTPDQLNSTGIPQLLSLHLAPE
EEAESEEGEDYY
Download sequence
Identical sequences F1MKW1
9913.ENSBTAP00000015268 ENSBTAP00000015268 ENSBTAP00000015268

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]