SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSBTAP00000015304 from Bos taurus 76_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSBTAP00000015304
Domain Number 1 Region: 47-157
Classification Level Classification E-value
Superfamily Spermadhesin, CUB domain 4.45e-31
Family Spermadhesin, CUB domain 0.00057
Further Details:      
 
Domain Number 2 Region: 259-370
Classification Level Classification E-value
Superfamily Spermadhesin, CUB domain 3.27e-26
Family Spermadhesin, CUB domain 0.0015
Further Details:      
 
Domain Number 3 Region: 450-488
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.0000000000157
Family LDL receptor-like module 0.001
Further Details:      
 
Domain Number 4 Region: 164-200
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.00000000119
Family LDL receptor-like module 0.0013
Further Details:      
 
Domain Number 5 Region: 411-449
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.000000131
Family LDL receptor-like module 0.0021
Further Details:      
 
Domain Number 6 Region: 212-254
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.000000223
Family LDL receptor-like module 0.0023
Further Details:      
 
Domain Number 7 Region: 374-411
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.000000707
Family LDL receptor-like module 0.0025
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSBTAP00000015304   Gene: ENSBTAG00000011516   Transcript: ENSBTAT00000015304
Sequence length 859
Comment pep:known_by_projection chromosome:UMD3.1:14:62215198:62305653:1 gene:ENSBTAG00000011516 transcript:ENSBTAT00000015304 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MARRWNTKESPRWRSALVLLFLAGVYGNRALAEHSENVHISGVSTACGETPEQIRAPSGI
ITSPGWPSEYPARINCSWFIRANPGEIITISFQDFDIQGSRRCSLDWLTIETYKNIESYR
ACGSTIPPPYISSQDHVWIRFHSDDSISRKGFRLAYFSGKSEEPNCACDQFRCGNGKCIP
AAWKCNNMDECGDSSDEEICAREANPPTSASFQPCAYNQFQCLSRFTKVYTCLPESLKCD
GNIDCLDLGDEIDCDVPTCGQWLKYFYGTFNSPNYPDFYPPGSNCTWLIDTGDHRKVILR
FTDFKLDGTGYGDYVKIYDGLEENPHKLLRVLTAFDSHAPLTVVSSSGQIRVHFCADKVN
AARGFNATYQVDGFCLPWEIPCGGNWGCYTEQQRCDGYWHCPNGRDEINCTVCQKEEFPC
SRNGVCYPRSDRCNYQNHCPNGSDEKNCFFCQPGNFHCKNNRCVFESWVCDSQDDCGDGS
DEENCPVIVPTRVITAAVIGSLICGLLLVIALGCTCKLYSLRMFERRSFETQLSRVEAEL
LRREAPPSYGQLIAQGLIPPVEDFPVCSPNQASVLENLRLAVRSQLGFTSIRLPMAGRSS
NIWNRIFNFARSRHSGSLALVSADGDEVVPSQSTSREPERNHTHRSLFSVESDDTDTENE
RRDTAGASGGVTAPLPQKVPPTTAVEATVGASGSSSTQSTRGGHTETGRDVTSVEPPSVS
PARHQLTSALSRMTQGLRWVRFTLGRSSSSNQNQSPLRQLDNGVNGREEDDDVEMLIPVS
EGASDFDVNDCSRPLLDLASDQGQGFRQPYSGTNPGVRPSSRDGPCERCGIVHTAQIPDS
CLEATLKTETSDDEALLLC
Download sequence
Identical sequences E1BN03
NP_001179910.1.59421 NP_001179910.1.76553 ENSBTAP00000015304 ENSBTAP00000015304

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]