SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSBTAP00000015344 from Bos taurus 76_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSBTAP00000015344
Domain Number 1 Region: 1-151
Classification Level Classification E-value
Superfamily Galactose-binding domain-like 1.45e-55
Family N-terminal domain of xrcc1 0.00014
Further Details:      
 
Domain Number 2 Region: 397-550
Classification Level Classification E-value
Superfamily Ankyrin repeat 0.00000000456
Family Ankyrin repeat 0.0053
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSBTAP00000015344   Gene: ENSBTAG00000011549   Transcript: ENSBTAT00000015344
Sequence length 1262
Comment pep:known chromosome:UMD3.1:15:52291813:52329773:-1 gene:ENSBTAG00000011549 transcript:ENSBTAT00000015344 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MAPVRISHVVSFSSQDPKYPVENLLNPDSQRGPWLSCPQDKSGQLKVELQLERAVPIGYI
DVGNCGCAFLQIDVGRSSWSLDRPFVTLLPATMLMSLADSKQGKNRSGVRMFKDADFLAP
ASSESWDRLRLSCSQPFTRHQPFGLAFLRVCSSLDSLDDPVEGPSVPVSSGLSQGSSDAQ
ESGPSPWLANPSIRRTFFPDPQTTTKEISELRNFLKQLQPGTLGRSACMVLSAAHRAPPA
RVANPKTNHAEPGPAHQDSTEPRTEEQNTEKDVGRAKRRKVGARRPVSNSNSRPNQRGLA
KAGQREHLRPLARSSRVQESGWCPICAGSFSIDLLPQHAATCGGASLPPPASPASSPSSS
PHVLRFRCVALTPVPLVSRPQPNWTEIVNRKLKFPAPLLGAIQEGHTGLVQQLLEVGVEA
PGGGPGGPPRNVEEAEDRSWREALNLAIRLGHEAITDVLLANVKFDFRQIHEALLVAVDT
NQPAVVRHLLARLEREKGRKVDTRSSSLAFFDSSIDGSRFAPGVTPLTLACQKDLYEIAQ
LLMGQGHTIARPHPVSCACLECSNARRYDLLKFSLSRINTYRGIASRAHLSLASEDAMLA
AFQLSRELRHLARKEPEFKPEYIALESLSQDYGFELLGMCRNQSEVTAVLNDLGEDSETE
PEAEGLGQAFEEGIPNLARLRLAVNYNQKRFVAHPICQQVLSSIWCGNLAGWRGSTTIWK
LFIAFLIFLTMPFLCLGYWLAPKSRLGHLLKIPVLKFLLHSASYLWFLIFLLGESLVMET
QLSTFRGRSQSVWETSLHMVWVAGFLWFECKEVWIEGLRSYLLDWWNFLDMVILSLYLAA
FTLRLLLAGLAHKHCRDAPDGAACHYFTSAERSEWRTEDPQFLAEVLFAVTSMLSFTRLA
SILPAHESLGTLQISMGRMIDDMIRFMFILMIILTAFLCGLNNIYVPYQETERLGNFNET
FQFLFWTMFGMEEHSVVDMPQFLVPEFVGRALYGIFTIVMVIVLLNMLIAMITNSFQKIE
DAADVEWKFARSKLYLSYFREGLTLPVPFNILPSPKAIFYLLRRVFRFICCCHLCCKTKK
PDYPPIPTFANPGAGAGPGEGERGSYRLRVIKALVQRYIETAQREFEETRRKDLGNRLTE
LTKTVSRLQSEVAGVQRAVVEAGPRRPPGGASVLSRYITRVRNSFQNLGPPIPETPELTV
PATVGTQESSETGLPDAGGAQAPASGESGPSSPAHVLVHREQESEGAGDLPQEADLGAKE
GT
Download sequence
Identical sequences E1BMQ7
ENSBTAP00000015344 NP_776902.3.59421 NP_776902.3.76553 ENSBTAP00000015344

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]