SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSBTAP00000015445 from Bos taurus 76_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSBTAP00000015445
Domain Number 1 Region: 685-981
Classification Level Classification E-value
Superfamily Protein kinase-like (PK-like) 1.04e-77
Family Protein kinases, catalytic subunit 0.0000000000325
Further Details:      
 
Domain Number 2 Region: 305-497
Classification Level Classification E-value
Superfamily L domain-like 1.28e-45
Family L domain 0.000000301
Further Details:      
 
Domain Number 3 Region: 13-186
Classification Level Classification E-value
Superfamily L domain-like 9.92e-42
Family L domain 0.000000839
Further Details:      
 
Domain Number 4 Region: 482-613
Classification Level Classification E-value
Superfamily Growth factor receptor domain 1.88e-24
Family Growth factor receptor domain 0.000000184
Further Details:      
 
Domain Number 5 Region: 161-316
Classification Level Classification E-value
Superfamily Growth factor receptor domain 3.14e-18
Family Growth factor receptor domain 0.0000000449
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSBTAP00000015445   Gene: ENSBTAG00000011628   Transcript: ENSBTAT00000015445
Sequence length 1185
Comment pep:known_by_projection chromosome:UMD3.1:22:892005:1069280:-1 gene:ENSBTAG00000011628 transcript:ENSBTAT00000015445 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MKKHELLCQGTSNKLTQLGTFEDHFLSLQRMFNNCEVVLGNLEITYMQSSYNLSFLKTIQ
EVAGYVLIALNTVEKIPLENLQIIRGNVLYENTHALAVLSNYGANKTGLRELPLRNLQEI
LQGAVRFSNNPVLCNVETIQWRDIVNPDFLSNMTGDFQNQQGNCPKCDPACLNRSCWGAG
EENCQKLTKIICAQQCSGRCRGRSPSDCCHNQCAAGCTGPRESDCLVCRRFRDEATCKDT
CPPLMLYDPTTYEMKVNPLGKYSFGATCVKKCPRNYVVTDHGSCVRACSSDSQEVEEDGV
RKCKKCDGPCGKVCNGIGIGEFKDTLSINATNIKHFRNCTSISGDLHILPVAFRGDSFTR
TAPLDPKELDILRTVKEITGFLLIQAWPENRTDLHAFENLEIIRGRTKQHGQFSLAVVGL
DITSLGLRSLKEISDGDVIISGNRNLCYADTIRWKKLFGTSTQKTKILNNRSEKQCKAAG
HICHPLCSSEGCWGPGPKYCMSCQNFSRGKECVGKCNILEGEPREFVENSECVQCHPECL
PQAMNVTCTGRGPGNCVKCAHYIDGPHCVKTCPAGVAGENGTLIWKFADANHVCLLCHPN
CTYGCEGPGLEGCPQKGPKIPSIATGIVGGLLLVVVLALSVGLFMRRRHIVRKRTLRRLL
QERELVEPLTPSGEAPNQALLRILKETEFKKVKVLGSGAFGTVYKGLWIPEGEKVKIPVA
IKELREATSPKANKEILDEAYVMASVDNPHVCRLLGICLTSTVQLITQLMPFGCLLDYVR
EHKDNVGSQYLLNWCVQIAKGMNYLEDRRLVHRDLAARNVLVKTPQHVKITDFGLAKLLG
AEEKEYHAEGGKVPIKWMALESILHRIYTHQSDVWSYGVTVWELMTFGSKPYDGIPASEI
STVLEKGERLPQPPICTIDVYMIMVKCWMIDADSRPKFRELILEFSKMARDPQRYLVIQG
DERMHLPSPTDSNFYRALMDEEDMEDVVDADEYLVPQQGFFHSPTTSRTPLLSSLSTSSN
TPTVTCVDRNGSYPLKEDSFLQRYSSDPTGALIEDSMDDTFLPVPEYVNQSVPKRPAGSV
QNPVYHNQPLYPAPGRDPQYQNSLSNAVDNPEYLNTTHPACINGVLDGPALWAQKGSHQF
SLDNPDYQQAFFPKEAKSNGIFKGPAAENAEYLRAAPAGSDFTGA
Download sequence
Identical sequences F1N7F3
ENSBTAP00000015445 ENSBTAP00000015445

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]