SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSBTAP00000015545 from Bos taurus 76_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSBTAP00000015545
Domain Number 1 Region: 1127-1345
Classification Level Classification E-value
Superfamily Fibrinogen C-terminal domain-like 3.53e-86
Family Fibrinogen C-terminal domain-like 0.000000844
Further Details:      
 
Domain Number 2 Region: 595-768
Classification Level Classification E-value
Superfamily Fibronectin type III 4.05e-24
Family Fibronectin type III 0.0000096
Further Details:      
 
Domain Number 3 Region: 955-1124
Classification Level Classification E-value
Superfamily Fibronectin type III 2.13e-21
Family Fibronectin type III 0.0012
Further Details:      
 
Domain Number 4 Region: 778-937
Classification Level Classification E-value
Superfamily Fibronectin type III 4.92e-21
Family Fibronectin type III 0.0011
Further Details:      
 
Domain Number 5 Region: 328-504
Classification Level Classification E-value
Superfamily Fibronectin type III 4.55e-20
Family Fibronectin type III 0.0016
Further Details:      
 
Domain Number 6 Region: 502-592
Classification Level Classification E-value
Superfamily Fibronectin type III 0.0000000000000658
Family Fibronectin type III 0.00000409
Further Details:      
 
Weak hits

Sequence:  ENSBTAP00000015545
Domain Number - Region: 208-231
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00167
Family Integrin beta EGF-like domains 0.042
Further Details:      
 
Domain Number - Region: 239-262
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00263
Family Integrin beta EGF-like domains 0.083
Further Details:      
 
Domain Number - Region: 299-324
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00526
Family EGF-type module 0.037
Further Details:      
 
Domain Number - Region: 270-294
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00984
Family Integrin beta EGF-like domains 0.075
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSBTAP00000015545   Gene: ENSBTAG00000011706   Transcript: ENSBTAT00000015545
Sequence length 1358
Comment pep:known_by_projection chromosome:UMD3.1:16:58006950:58156083:-1 gene:ENSBTAG00000011706 transcript:ENSBTAT00000015545 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MGADRETVVLKNVLIGINLILLGSLLEPSECQLEVTMGRVQRPAVEEEGGAASYNASGKE
QPVVFNHVYNINVPLDSLCSSGLEASAEHEVSTEDEVLTEYTGQTSDHESQVTFTHRINL
PKKACPCASSAQVLQELLSRIEMLEREVSVLRDQCTSNCCPESAATGQLDYIPHCSGHGN
FSLESCGCICDQGWFGKNCSEPYCPLGCSSRGVCVDGQCVCDSEYSGDDCSELRCPTDCS
SRGLCVDGECVCEEAYTGEDCSELRCPGDCSGKGICANGTCLCQEGYVGEDCGQRRCPNA
CSGRGHCQEGLCLCEEGFQGPDCSAVAPPEDLRVAGISDRSIELEWDGPMAVTEYVISYQ
PTALGGLQLQQRVPGDWSGVTISELEPGLTYNISVYAVISNILSLPITAKVATHLSTPQG
LRFKTITETTVEVQWEPFSFSFDGWEISFIPKNNEGGVIAQLPSDVTSFNQTGLKPGEEY
IVNVVALKEQARSPPTSASVSTVIDGPTHILVRDVSDTVAFVEWTPPRAKVDFILLKYGL
VGGEGGKTTFRLQPPLSQYSVQALRPGSRYEVWVSAVRGTNESEATATQFTTEIDAPKNL
RVGSRTATSLELEWDNSEAEVQEYKVEYSTLAGEQYHELLVPKTIGPTSRATLTDLVPGT
EYGIGISAIMNSQQSVPATMNARTELDSPRDLMVTASSETSISLIWTKASGPIDHYRITF
TPSSGIASEVTVPKDRTSYTLTDLEPGAEYIISITAERGRQQSLESTVDAFTGFRPISHL
HFSHVTSSSVNITWSDPSPPADRLILNYSPRDEEEEMMEVSLDATKRHAVLMGLQPATEY
IVNLVAVHGTVSSEPIVGSITTGIDPPKDITISNVTKDSVMVSWSPPVASFDYYRVSYRP
TQVGRLDSSVVPNTVTEFTITKLYPATEYEISLNSVRGREESERICTLVHTAMDNPADLT
ATNITPTEALLQWKAPMSEVENYVIVLTHFAVAGETILVDGDSEEFQLVDLLPRTHYTVT
MYATSGPLTSGTVSTNFSTLLDAPANLTASEVTRQSALISWQPPRAEIENYILTYKSTDG
SRKELIVDAEDTWIRLEGLSESTDYTVLLQAAQDTERSSITSTAFVTGGRVFPHPQDCAQ
HLMNGDTLSGVYTIFLNGELSQKLQVYCDMTTDGGGWIVFQRRQNGQTDFFRKWAEYRVG
FGNLEDEFWLGLDNIHRITSQGRYELRVDMRDGQETAFASYDRFSVEDNRSLYKLRLGGY
NGTAGDSLSYHQGRPFSTEDRDNDIAVTNCAMSYKGAWWYKNCHRTNLNGKYGESRHSQG
INWYHWKGHEFSIPFVEMKMRPYSHRLVAGRKRRSLQF
Download sequence
Identical sequences E1BKN2
NP_001192857.1.59421 NP_001192857.1.76553 XP_005217150.1.76553 ENSBTAP00000015545 9913.ENSBTAP00000015545 ENSBTAP00000015545

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]