SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSBTAP00000015563 from Bos taurus 76_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSBTAP00000015563
Domain Number 1 Region: 34-410
Classification Level Classification E-value
Superfamily Periplasmic binding protein-like I 1.15e-68
Family L-arabinose binding protein-like 0.0023
Further Details:      
 
Domain Number 2 Region: 430-545,664-804
Classification Level Classification E-value
Superfamily Periplasmic binding protein-like II 5.1e-68
Family Phosphate binding protein-like 0.000000000681
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSBTAP00000015563   Gene: ENSBTAG00000033153   Transcript: ENSBTAT00000015563
Sequence length 908
Comment pep:known chromosome:UMD3.1:9:48476204:49218551:-1 gene:ENSBTAG00000033153 transcript:ENSBTAT00000015563 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MKIISPVLSNPVFRRTIKLLLCLLWIGYSQGTTHVLRFGGIFEYVESGPMGAEELAFRFA
VNTINRNRTLLPNTTLTYDTQKINLYDSFEASKKACDQLSLGVAAIFGPSHSSSANAVQS
ICNALGVPHIQTRWKHQVSDNKDSFYVSLYPDFSSLSRAILDLVQFFKWKTVTVVYDDST
GLIRLQELIKAPSRYNLRLKIRQLPADTKDAKPLLKEMKRGKEFHVIFDCSHEMAAGILK
QALAMGMMTEYYHYIFTTLDLFALDVEPYRYSGVNMTGFRILNTENTQVSSIIEKWSMER
LQAPPKPDSGLLDGFMTTDAALMYDAVHVVSVGVQQFPQMTVSSLQCNRHKPWRFGTRFM
SLIKEAHWEGLTGRITFNKTNGLRTDFDLDVISLKEEGLEKIGTWDPASGLNMTESQKGK
PANITDSLSNRSLIVTTILEEPYVLFKKSDKPLYGNDRFEGYCIDLLRELSTILGFTYEI
RLVEDGKYGAQDDANGQWNGMVRELIDHKADLAVAPLAITYVREKVIDFSKPFMTLGISI
LYRKPNGTNPGVFSFLNPLSPDIWMYILLAYLGVSCVLFVIARFSPYEWYNPHPCNPDSD
VVENNFTLLNSFWFGVGALMQQGSELMPKALSTRIVGGIWWFFTLIIISSYTANLAAFLT
VERMESPIDSADDLAKQTKIEYGAVEDGATMTFFKKSKISTYDKMWAFMSSRRQSVLVKS
NEEGIQRVLTSDYAFLMESTTIEFVTQRNCNLTQIGGLIDSKGYGVGTPMGSPYRDKITI
AILQLQEEGKLHMMKEKWWRGNGCPEEESKEASALGVQNIGGIFIVLAAGLVLSVFVAVG
EFLYKSKKNAQLEKRSFCSAMVEELRMSLKCQRRLKHKPQAPVIVKTEEVINMHTFNDRR
LPGKETMA
Download sequence
Identical sequences F1MG21
NP_001179992.1.59421 NP_001179992.1.76553 XP_004011292.1.66739 XP_010839562.1.44457 XP_011995216.1.54773 XP_011995217.1.54773 XP_011995218.1.54773 XP_012038106.1.66739 XP_014952859.1.66739 ENSBTAP00000015563 ENSBTAP00000015563

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]