SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSBTAP00000015593 from Bos taurus 76_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSBTAP00000015593
Domain Number 1 Region: 32-226
Classification Level Classification E-value
Superfamily Metalloproteases ("zincins"), catalytic domain 1.2e-58
Family Astacin 0.0000921
Further Details:      
 
Domain Number 2 Region: 498-608
Classification Level Classification E-value
Superfamily Spermadhesin, CUB domain 2.75e-37
Family Spermadhesin, CUB domain 0.00022
Further Details:      
 
Domain Number 3 Region: 658-765
Classification Level Classification E-value
Superfamily Spermadhesin, CUB domain 4.71e-37
Family Spermadhesin, CUB domain 0.0002
Further Details:      
 
Domain Number 4 Region: 342-451
Classification Level Classification E-value
Superfamily Spermadhesin, CUB domain 6.93e-37
Family Spermadhesin, CUB domain 0.00026
Further Details:      
 
Domain Number 5 Region: 233-342
Classification Level Classification E-value
Superfamily Spermadhesin, CUB domain 2.62e-35
Family Spermadhesin, CUB domain 0.00048
Further Details:      
 
Domain Number 6 Region: 789-882
Classification Level Classification E-value
Superfamily Spermadhesin, CUB domain 2.22e-28
Family Spermadhesin, CUB domain 0.00044
Further Details:      
 
Domain Number 7 Region: 609-652
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000000000138
Family EGF-type module 0.011
Further Details:      
 
Domain Number 8 Region: 453-495
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000000113
Family EGF-type module 0.0072
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSBTAP00000015593   Gene: ENSBTAG00000011743   Transcript: ENSBTAT00000015593
Sequence length 893
Comment pep:known_by_projection chromosome:UMD3.1:26:17567835:17642271:-1 gene:ENSBTAG00000011743 transcript:ENSBTAT00000015593 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
GKENALLPQSPGTLHAGAETFSPRVRRATTSRTERIWPGGVIPYVIGGNFTGSQRAIFKQ
AMRHWEKHTCVTFIERTDEESFIVFSYRTCGCCSYVGRRGGGPQAISIGKNCDKFGIVAH
ELGHVVGFWHEHTRPDRDQHVTIIRENIQPGQEYNFLKMEAGEVSSLGEMYDFDSIMHYA
RNTFSRGVFLDTILPRRDDNGVRPTIGQRVRLSQGDIAQARKLYKCPACGETLQDTMGNF
SAPGFPNGYPSYSHCVWRISVTPGEKIVLNFTSMDLFKSRLCWYDYVEVRDGYWRKAPLL
GRFCGDKVPEPLTSTDSRLWVEFRSSSNILGKGFFAVYEATCGGEINKDAGQIQSPNYPD
DYRPSKECVWRITVSEGYHVGLTFQAFEIERHDSCAYDYLEIRDGFTEDSALIGHFCGYE
KPDDVKSSSNRMWMKFVSDGSINKAGFAANFFKEVDECSWPDHGGCEQRCMNTLGSYKCM
CDPGYELAADKKACEVACGGFITKLNGTITSPGWPKEYPTNKNCVWQVVAPAQYRISLQF
EVFELEGNDVCKYDFVEVRSGLSPDARLHGKFCGSETPEVITSQSNNMRVEFKSDNTVSK
RGFRAHFFSDKDECAKDNGGCQHECVNTFGSYLCRCRNGYRLHENGQDCKEAGCVHKISS
TEGSLVSPNWPDKYPSRRECTWTISSTAGHRVKLTFNEFEIEQHQECAYDHLELYDGPDS
QAPILGRFCGSKKPDPVVASGSSLFLRFYSDASVQRRGFQAVHSTECGGRLKAEVQTKEL
YSHAQFGDNNYPSQARCDWVIVAEDGYGVELIFRTFEVEEEADCGYDYMEAFDGYDSTAP
RLGRFCGSGPLEEIYSAGDSLMIRFHTDDTINKKGFHARYTSTKFQDALHMKK
Download sequence
Identical sequences F1MF35
9913.ENSBTAP00000015593 ENSBTAP00000015593 ENSBTAP00000015593

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]