SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSBTAP00000015694 from Bos taurus 76_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSBTAP00000015694
Domain Number 1 Region: 93-291
Classification Level Classification E-value
Superfamily L domain-like 8.69e-27
Family Ngr ectodomain-like 0.0046
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSBTAP00000015694   Gene: ENSBTAG00000011824   Transcript: ENSBTAT00000015694
Sequence length 299
Comment pep:known chromosome:UMD3.1:8:85453132:85468721:1 gene:ENSBTAG00000011824 transcript:ENSBTAT00000015694 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MKTLQSTLLLFLFVPLIKPAPPSQQDSRIIYDYGTDNLEETFFSQDYEDKYLDGKSTKEK
ETMIIVPDEKSFQLQKDETITPLPPKKENDEMPTCLLCVCLSGSVYCEEVDIDAVPPLPK
ESAYLYARFNKIKKLTAKDFADIPNLRRLDFTGNLIEDIEDGTFSKLSLLEELTLAENQL
LKLPVLPPKLTLFNAKYNKIKSRGIKANTFKKLHNLSFLYLDHNALESVPLNLPESLRVI
HLQFNNITSITDDTFCKANDTSYIRDRIEEIRLEGNPVILGKHPNSFICLKRLPIGSYI
Download sequence
Identical sequences A5D9E8
ENSBTAP00000015694 9913.ENSBTAP00000015694

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]