SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSBTAP00000015703 from Bos taurus 76_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSBTAP00000015703
Domain Number 1 Region: 363-770
Classification Level Classification E-value
Superfamily ALDH-like 1.96e-90
Family ALDH-like 0.000000113
Further Details:      
 
Domain Number 2 Region: 71-353
Classification Level Classification E-value
Superfamily Carbamate kinase-like 1.83e-50
Family PyrH-like 0.00067
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSBTAP00000015703   Gene: ENSBTAG00000011832   Transcript: ENSBTAT00000015703
Sequence length 795
Comment pep:known chromosome:UMD3.1:26:16954147:16995264:-1 gene:ENSBTAG00000011832 transcript:ENSBTAT00000015703 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MLSQVCRSGSQSFTQRLLPWVQPTILSRSRRVQPSAIRHVRSWSNIPFITVPLSRTHGKS
FAHRSELKHAKRIVVKLGSAVVTRGDECGLALGRLASIVEQVSVLQNQGREMMLVTSGAV
AFGKQRLRHEILLSQSVRQALHSGQNHLKEMAIPVLEARACAAAGQSGLMALYEAMFTQY
SICAAQILVTNLDFHDEQKRRNLNGTLHELLRMNIVPIVNTNDAVVPPAEPNSDLQGVNV
ISVKDNDSLAARLAVEMKTDLLIVLSDVEGLFDSPPGSDDAKLIDIFYPGDQQSVTFGTK
SRVGMGGMEAKVKAALWALQGGTSVVIANGTHPKVSGHVITDIVEGKKVGTFFSEVKPAG
PTVEQQGEMARSGGRMLATLEPEQRAEIIHHLADLLTDQRDEILLANKKDLEEAEGRLAT
PLLKRLSLSTSKLNSLAIGLRQIAASSQDSVGRVLRRTRIAKDLELEQVTVPIGVLLVIF
ESRPDCLPQVAALAIASGNGLLLKGGKEASHSNRILHLLTQEALSIHGVKEAVQLVNTRE
EVEDLCRLDKMIDLIIPRGSSQLVRDIQKAAKGIPVMGHSEGICHMYVDSEASVDKVTRL
VRDSKCEYPAACNALETLLIHRDLLRTPLFDQIIDMLRVEQVKIHAGPKFASYLTFSPSE
VKSLRTEYGDLELCIEVVDSVQDAIDHIHKYGSSHTDVIVTENEKTAEFFLQHVDSACVF
WNASTRFSDGYRFGLGAEVGISTSRIHARGPVGLEGLLTTKWLLRGQDHVVSDFSEHGSL
KYLHENLPIPQRNTN
Download sequence
Identical sequences Q2KJH7
ENSBTAP00000015703 NP_001039646.1.59421 NP_001039646.1.76553 XP_010831293.1.44457 XP_019808433.1.53367 9913.ENSBTAP00000015703 ENSBTAP00000015703

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]