SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSBTAP00000015704 from Bos taurus 76_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSBTAP00000015704
Domain Number 1 Region: 65-358
Classification Level Classification E-value
Superfamily L domain-like 5.1e-49
Family Ngr ectodomain-like 0.0017
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSBTAP00000015704   Gene: ENSBTAG00000011836   Transcript: ENSBTAT00000015704
Sequence length 422
Comment pep:known chromosome:UMD3.1:8:85477017:85479293:-1 gene:ENSBTAG00000011836 transcript:ENSBTAT00000015704 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MGFSSLVCVLFFFLGVKVYCQYESYQWDEDYDQEPDDVYQTEFQFQQNINYEAPFHQHTL
GCASECFCPPNFPSSMYCDNRKLKTIPNIPAHIQQVYLQFNEIEAVTADSFINATHLKEI
NLSHNKIKSQKIDHGVFAKLPNLLQLHLQHNNLEDFPFPLPKSLERIFLGYNEISRLQTN
AVNGLVNLTMLDLCFNKIDDSVLQEKVLAKMEKLMQLNLCNNRLESMPPGLPSSLMYLSL
ENNSISSIPENYFNKLPKLHALRISHNKLQDIPYNIFNLSNLIELNVGHNKLKQAFYIPR
NLEHLYLENNEIENVNVTVMCPSVDPLHYHHLTHIRIDQNKLKAPISSYIFLCFPHIHTI
YYGEQQSTNGQTIQLKTQVFRRFQDDGDSEDHDDHHEGPEEEGTEENIDAHYYGSQEWQE
TI
Download sequence
Identical sequences G3X6Y4
ENSBTAP00000015704 ENSBTAP00000015704

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]