SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSBTAP00000015712 from Bos taurus 76_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSBTAP00000015712
Domain Number 1 Region: 294-481
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 1.15e-50
Family SPRY domain 0.000024
Further Details:      
 
Domain Number 2 Region: 4-88
Classification Level Classification E-value
Superfamily RING/U-box 7.07e-30
Family RING finger domain, C3HC4 0.006
Further Details:      
 
Domain Number 3 Region: 89-152
Classification Level Classification E-value
Superfamily B-box zinc-binding domain 2.29e-18
Family B-box zinc-binding domain 0.0017
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSBTAP00000015712   Gene: ENSBTAG00000037465   Transcript: ENSBTAT00000015712
Sequence length 487
Comment pep:known chromosome:UMD3.1:15:48559281:48578157:-1 gene:ENSBTAG00000037465 transcript:ENSBTAT00000015712 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MTSAVLVDIQDEVTCPICLELLTEPLSIDCGHSFCQACITADNKESMPGQEGQSRCPVCQ
TSYWLGNLRPNRHLANIAERLREVVLGSGKQLKVILCVHHGEKLQLFCEEDGKLICWLCE
RSQEHRGHHTFLMEEIAQEYQEKFQESLKKLRQEQQEAEKLAAVIREKRISWKNQMEPER
HRIQKQFDHLRSILDKEEQRQLKKLEEEERRGLNIIAEAEVELVQQSQSLRELISDLEHR
CQGSATELLQDVSDVAKRSEFWTLKKPEALPTKLKSMFRAPDLKKMLRVFRELTDVQSYW
VDVTLNPHTANLNLVLSKNRRQVRFVGAQLSGSHLEEHYGCGVLGSQHFSSGKHYWEVDV
AKKTDWILGVCSDSMGPAFSFNQFANNRNVYSRYQPQSGYWVIGLHHKHEYRAYEESSTS
LLLSMTVPPRRVGVFLDYDAGTVSFYNVTNHGFPIYTFSKYYFPTTLCPYFNPCNCVFPM
TLRRPSS
Download sequence
Identical sequences F1N541
NP_001192118.1.59421 NP_001192118.1.76553 ENSBTAP00000015712

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]