SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSBTAP00000015717 from Bos taurus 76_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSBTAP00000015717
Domain Number 1 Region: 283-397,519-665
Classification Level Classification E-value
Superfamily Periplasmic binding protein-like II 8.04e-65
Family Phosphate binding protein-like 0.00000000162
Further Details:      
 
Domain Number 2 Region: 7-268
Classification Level Classification E-value
Superfamily Periplasmic binding protein-like I 3.49e-38
Family L-arabinose binding protein-like 0.01
Further Details:      
 
Domain Number 3 Region: 421-516
Classification Level Classification E-value
Superfamily Voltage-gated potassium channels 0.00000615
Family Voltage-gated potassium channels 0.011
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSBTAP00000015717   Gene: ENSBTAG00000011833   Transcript: ENSBTAT00000015717
Sequence length 754
Comment pep:known_by_projection chromosome:UMD3.1:X:7180735:7482667:1 gene:ENSBTAG00000011833 transcript:ENSBTAT00000015717 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MRPALKGAILSLLGHYKWEKFVYLYDTERGFSILQAIMEAAVQNNWQVTARSVGNIKDVQ
EFRRIIEEMDRRQEKRYLIDCEVERINTILEQVVILGKHSRGYHYMLANLGFTDILLERV
MHGGANITGFQIVNNENPMVQQFIQRWVRLDEREFPEAKNAPLKYTSALTHDAILVIAEA
FRYLRRQRVDVSRRGSAGDCLANPAVPWSQGIDIERALKMVQVQGMTGNIQFDTYGRRTN
YTIDVYEMKVTGSRKAGYWNEYERFVPFSDQQISNDSASAENRTIVVTTILESPYVMYKK
NHEQLEGNERYEGYCVDLAYEIAKHVRIKYKLSIVGDGKYGARDPETKIWNGMVGELVYG
RADIAVAPLTITLVREEVIDFSKPFMSLGISIMIKKPQKSKPGVFSFLDPLAYEIWMCIV
FAYIGVSVVLFLVSRFSPYEWHLEDNNEEPRDPQSPPDPPNEFGIFNSLWFSLGAFMQQG
CDISPRSLSGRIVGGVWWFFTLIIISSYTANLAAFLTVERMVSPIESAEDLAKQTEIAYG
TLDSGSTKEFFRRSKIAVYEKMWSYMKSAEPSVFTKTTADGVARVRKSKGKFAFLLESTM
NEYIEQRKPCDTMKVGGNLDSKGYGVATPKGSALRNAVNLAVLKLNEQGLLDKLKNKWWY
DKGECGSGGGDSKDKTSALSLSNVAGVFYILVGGLGLAMMVALIEFCYKSRAESKRMKLT
KNTQNFKPAPATNTQNYATYREGYNVYGTESVKI
Download sequence
Identical sequences E1BGZ0
ENSBTAP00000015717 ENSBTAP00000015717

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]