SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSBTAP00000015726 from Bos taurus 76_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSBTAP00000015726
Domain Number 1 Region: 297-663
Classification Level Classification E-value
Superfamily L domain-like 3.51e-49
Family Ngr ectodomain-like 0.0013
Further Details:      
 
Domain Number 2 Region: 100-158
Classification Level Classification E-value
Superfamily FnI-like domain 0.0000000000000335
Family VWC domain 0.0018
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSBTAP00000015726   Gene: ENSBTAG00000024081   Transcript: ENSBTAT00000015726
Sequence length 679
Comment pep:known chromosome:UMD3.1:8:85540501:85579683:-1 gene:ENSBTAG00000024081 transcript:ENSBTAT00000015726 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MKFSSLYCFLLLLIFQTDFGQNEETSRRQRRKMYHRRLRKSSLSTHRSVRQPGIQQMKTV
TPAAKLPIINLDYSIEENFESFLSVPGVESSYNVLPGKKGHCLANGMIMYNKAVWSPEPC
TTCLCLNGKVLCDETKCHPQMCPQTIIPEGECCPVCSDTEQREPTNLPHKQQSPPWEEMN
RALRKEELQLEEDEEEVKQDENREQKKKTFRPGDWGRPINEGQSREGKAQRPEEEGRQAH
QHRNPARENEEDDDEEEEDDDDEEEDDDDEDETIRGDTFRMPPRLPIPATPRGIPSLPSM
CSLSYKTISCISADLTQIPPLTAPEITSLELIDNSITSIPDEAFNGLNLERLDLSKNNIT
SSGIGPKAFKFLKNLMRLNMDGNNLVTIPSELPSTLEELKINENKLQVIDEESLSDLNQL
VTLELEGNNLSETNVNSLAFKPLKSLSYLRLGRNKFRIIPQGLPASIEELYLENNQIEEI
TEISFNHTRKINVIGLRYNKIEENRIAPLAWINQENLESIDLSYNKLYHVPSYLPKSLVH
LVLIGNQIERIPGYVFGHMEPGLEYLYLSFNKLVDDGIDRVSFYGAYHSLRELFLDHNEL
KSIPPGVQEMKALHFLRLNNNKIRNILPEQICNAEEDDDSNLQHLHLENNYIKTREIPSY
AFSCIRSYSSIVLKPQNIK
Download sequence
Identical sequences F1MG02
ENSBTAP00000015726 ENSBTAP00000015726

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]