SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSBTAP00000015881 from Bos taurus 76_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSBTAP00000015881
Domain Number 1 Region: 827-881
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000000001
Family Laminin-type module 0.0000586
Further Details:      
 
Domain Number 2 Region: 723-774
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000000017
Family Laminin-type module 0.023
Further Details:      
 
Domain Number 3 Region: 285-343
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000000000234
Family Laminin-type module 0.037
Further Details:      
 
Domain Number 4 Region: 883-931
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000000131
Family Laminin-type module 0.00017
Further Details:      
 
Domain Number 5 Region: 934-984
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000000109
Family Laminin-type module 0.023
Further Details:      
 
Domain Number 6 Region: 446-496
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000000026
Family Laminin-type module 0.011
Further Details:      
 
Domain Number 7 Region: 397-446
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000000176
Family Laminin-type module 0.0073
Further Details:      
 
Domain Number 8 Region: 341-399
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000446
Family Laminin-type module 0.014
Further Details:      
 
Domain Number 9 Region: 772-829
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000865
Family Laminin-type module 0.00027
Further Details:      
 
Domain Number 10 Region: 982-1027
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000209
Family Laminin-type module 0.019
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSBTAP00000015881   Gene: ENSBTAG00000011966   Transcript: ENSBTAT00000015881
Sequence length 1608
Comment pep:known chromosome:UMD3.1:16:65545497:65662819:1 gene:ENSBTAG00000011966 transcript:ENSBTAT00000015881 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MRGSDRAAAALRPRGRVWPVLVVLAAAAAGCARAAMDECTDEGGRPQRCMPEFVNAAFNV
TVVATNTCGTPPEEYCVQTGVTGVTKSCHLCDAGQPHLQHGAAFLTDYNNQADTTWWQSQ
TMLAGVQYPNSINLTLHLGKAFDITYVRLKFHTSRPESFAIYKRTREDGPWIPYQYYSGS
CENTYSKATRGFIRTGGDEQQALCTDEFSDISPLTGGNVAFSTLEGRPSAYNFDNSPVLQ
EWVTATDIRVTLNRLNTFGDEVFNDPKVLKSYYYAISDFAVGGRCKCNGHASECVKNEFD
KLVCNCKHNTYGVDCEKCLPFFNDRPWRRATAESASECQPCDCNGRSQECYFDPELYRST
GHGGHCTNCQDNTDGAKCERCRENFFRLGNREACSPCHCSPVGSLSTQCDSYGRCSCKPG
VMGDKCDRCQPGYHSLTEAGCRPCSCNPSGSIDECNIETGRCVCKDNVEGFNCERCKPGF
FNLESSNPRGCTPCFCFGHSSVCTNAVGYSVYSITSTFETDEDGWRAEQRDGSEASFEWS
SERQDIAVISDSYFPRYFIAPAKFLGKQVLSYGQNFSFSFRVDRRDTRLSAEDLVLEGAG
MRVSVPLIAQGNSYPSETTVKYVFRLHEATDYPWRPTLTPFEFQKLLNNLTSIKIRGTYS
ERSAGYLDDVTLASAHPGPGVPATWVESCTCPVGYGGQFCEVCLSGYRRETPSLGPYSPC
VLCTCNGHSETCDPESGVCNCRDNTAGPNCEKCSDGYYGDSTAGTSLDCQPCPCPGGSSC
AVVPKTQEVVCTNCPTGTTGRRCELCDDGHFGDPLGSNGPVRLCRLCQCNDNIDPNAVGN
CNRLTGECLKCIYNTAGFYCDRCKDGFFGNPLAPNPADKCRACDCNPYGTVKQQSSCNPV
TGQCECLPHVTGRDCGACDPGFYNLQSGQGCERCDCHALGSTNGQCDVHSGQCECQPGIT
GQHCEHCEVNHFGFGPEGCKPCDCHPEGSLSLQCKDDGRCECREGFVGNRCDQCEENYFY
NRSWPGCQECPACYRLVKDKVADHRAKLRELENLIANLGTGDEMVTDQAFEDRLKEVERE
VTDLLREAQDVKDVDQNLMDRLQRVNNTLFSQISRLQNIRNTIEETGNLAEQARSRVEST
EQLIEIASRELEKAKVAIANVSVTQPESTGDPNNMTLLAEEARKLAERHKQEADDIVRVA
KTANDTSAEAYNLLLRTLAGENQTASEIEELNRKYEQAKNISQDLEKQAARVHEEAKKAG
DKAVEIYASVAQLTPVDSEALENEANKIKKEAEDLDRLIDQKLKDYEDLRDDMRGKEFEV
KKLLEKGKTEQQTADQLLARADAAKALAEEAAEKGRNTLQEANDILNNLKDFDRRVNDNK
TAAEEALRRIPAINQTIIEANEKTREAQQALGNAAADATEARNKAHEAERIASAVQKNAT
STKAEAERTFAEVTDLDNEVNNMLKQLQEAEKELKKKQEDADQDMMMAGMASQAAQEAEI
NARKAKNSVTNLLNLINDLLEQLGQLDTVDLNKLNEIEGTLNKAKEEMKVSDLDRKVSNL
ENEARKQEAAIMDYNRDIEEILKDIRNLEDIKKTLPSGCFNTPSIEKP
Download sequence
Identical sequences F1MD77
ENSBTAP00000015881 ENSBTAP00000015881

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]