SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSBTAP00000015885 from Bos taurus 76_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSBTAP00000015885
Domain Number 1 Region: 275-428
Classification Level Classification E-value
Superfamily Galactose-binding domain-like 5.95e-48
Family Discoidin domain (FA58C, coagulation factor 5/8 C-terminal domain) 0.00000603
Further Details:      
 
Domain Number 2 Region: 431-596
Classification Level Classification E-value
Superfamily Galactose-binding domain-like 7.09e-45
Family Discoidin domain (FA58C, coagulation factor 5/8 C-terminal domain) 0.0000155
Further Details:      
 
Domain Number 3 Region: 148-266
Classification Level Classification E-value
Superfamily Spermadhesin, CUB domain 1.83e-33
Family Spermadhesin, CUB domain 0.000021
Further Details:      
 
Domain Number 4 Region: 36-142
Classification Level Classification E-value
Superfamily Spermadhesin, CUB domain 2.09e-33
Family Spermadhesin, CUB domain 0.00024
Further Details:      
 
Domain Number 5 Region: 642-794
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 2.37e-27
Family MAM domain 0.001
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSBTAP00000015885   Gene: ENSBTAG00000011971   Transcript: ENSBTAT00000015885
Sequence length 926
Comment pep:known_by_projection chromosome:UMD3.1:2:94455658:94573687:1 gene:ENSBTAG00000011971 transcript:ENSBTAT00000015885 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MDMFPLTWIFLALYFSGHEVRGQADQPCGGRLNSKDAGYITSPGYPQDYPSHQNCEWIVY
APEPNQKIVLNFNPHFEIEKHDCKYDFIEIRDGDSESADLLGKHCGNIAPPTIISSGSVL
YIKFTSDYARQGAGFSLRYEIFKTGSEDCSKNFTSPNGTIESPGFPDKYPHNLDCTFTIL
AKPKMEIILQFLTFDLEHDPLQVGEGDCKYDWLDIWDGIPHVGPLIGKYCGTKTPSELRS
ATGILSLTFHTDMAVAKDGFSARYYLVHQEPLENFQCNVPLGMESGRIANEQISASSMYS
DGRWTPQQSRLHGDDNGWTPNLDSSKEYLQVDLRFLTVLTAIATQGAISRETQNGYYVKS
YKLEVSTNGEDWMVYRHGKNHKVFQANNDATEVVLNKLHSPLLTRFVRVRPQTWHTGIAL
RLELFGCRVTDAPCSNMLGMLSGLIADSQISASSTREYLWSPSAARLVSSRSGWFPRIPQ
AQPGEEWLQVDLGAPKTVKGVIIQGARGGDSITAVEARAFVRKFKVSYSLNGKDWEHIQD
PRTQQPKLFEGNMHYDTPDIRRFDPVLAQYVRVYPERWSPAGIGMRLEVLGCDWTDSKPT
VETLGPTVKSEETTTPYPTDEEATDCGENCSFEDDKDLQLPSGFNCNFDFPEEPCGWMYD
HAKWLRSTWASSSSPDDRTFPDDRNFLRLQSDGRREGQYARLISPPVHLPRSPVCMEFQY
QATGGRGVALQVVREASQESKLLWVIREDQGGEWKHGRIILPSYDMEYQIVFEGVIGKGR
AGEIAIDDIRISTDVPLENCMEPISAFAVDIPEIHGREGYEDEIDDDYEVDWSNSSSPTS
GSGAPLADKEKSWLYTLDPILITIIAMSSLGVLLGATCAGLLLYCTCSYSGLSSRSCTTL
ENYNFELYDGLKHKVKMNHQKCCSEA
Download sequence
Identical sequences E1BEL6
ENSBTAP00000015885 9913.ENSBTAP00000015885 ENSBTAP00000015885 NP_001180166.1.59421 NP_001180166.1.76553

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]