SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSBTAP00000015995 from Bos taurus 76_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSBTAP00000015995
Domain Number 1 Region: 7-439
Classification Level Classification E-value
Superfamily ALDH-like 2.49e-123
Family ALDH-like 0.000000000686
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSBTAP00000015995   Gene: ENSBTAG00000012054   Transcript: ENSBTAT00000015995
Sequence length 466
Comment pep:known_by_projection chromosome:UMD3.1:29:46143363:46150095:-1 gene:ENSBTAG00000012054 transcript:ENSBTAT00000015995 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MDPFADTLQRLREAFVSGRTRPAKFRAAQLKGLSLFLQENKQLLQEALAQDLYKTAFHSE
VSELILCQNQVDFALRNLHTWMKDEPGAKNLMTQLDSVFIRKEPFGLVLILSPWNYPLNL
SLGPLVGALAAGNCVVLKPSEISKSTMKVLAKVLPRYLDQSCFAVVLGGPEETGRLLEHK
FDYIFFTGSPRVGKIVMAAAAKHLTPVTLELGGKNPCYVDDNCDPQTVANRVAFFRCFNT
GQTCVAPDYVLCSPEMQAKLVPALQSAITRFYGNDPQRSPDLGRIISQKHFQRLRGLLSC
GRVVIGGQSDESDLYIAPTVLVDVKETEPVMQEEIFGPILPIVNVRSLDQAIDFINRREK
PLALYAFSNSSQAVKQMLDRTSSGNFAGNQGFTFLTLTSLPFGGVGQSGMGRYHGKFSFD
TFSHHRACLLSHPGLEMLNNIRYPPYSDFEQKLITWALGSHSCTLL
Download sequence
Identical sequences F6RC46
ENSBTAP00000015995 ENSBTAP00000015995

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]