SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSBTAP00000016040 from Bos taurus 76_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSBTAP00000016040
Domain Number 1 Region: 360-485
Classification Level Classification E-value
Superfamily Growth factor receptor domain 2.56e-17
Family Growth factor receptor domain 0.023
Further Details:      
 
Domain Number 2 Region: 186-310
Classification Level Classification E-value
Superfamily Growth factor receptor domain 0.000000000267
Family Growth factor receptor domain 0.019
Further Details:      
 
Domain Number 3 Region: 481-539
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000000000795
Family EGF-type module 0.0091
Further Details:      
 
Domain Number 4 Region: 309-370
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000000293
Family EGF-type module 0.0066
Further Details:      
 
Domain Number 5 Region: 527-568
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000573
Family EGF-type module 0.025
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSBTAP00000016040   Gene: ENSBTAG00000012088   Transcript: ENSBTAT00000016040
Sequence length 706
Comment pep:known chromosome:UMD3.1:5:116616200:116695692:1 gene:ENSBTAG00000012088 transcript:ENSBTAT00000016040 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MERAAPSRRVPLLLLLLGGLSLLAAPAGADVSMEACCADGHRMATEHRACSLPYTSESKE
CRMVQEQCCQNQLEELHCATGINLANEQDSCATPRGDNTSLEAMFVKRCCHCCLLGRAAQ
AQGQSCEYSLMVGYQCGLVFRACCVKGQETADFAPGDGGDLQETAKVSEIEEEQEDPYLN
DRCRGGGPCKQQCRDTGEEVVCSCFVGYQLLPDGVSCEDVNECITGGQSCRLGETCVNTA
GSFRCQRDSSCGTGYELTEDNDCKDIDECESGIHNCLPDFICQNTLGSFRCRPKLQCKSG
FIQDALGNCIDINECLSISAPCPVGQTCINTEGSYTCQKNVPNCGRGYHLNEEGTRCVDV
DECSPPSEPCGPGHLCVNSPGSFRCECKAGYYFDGISRTCVDINECRRYPGRLCGHKCEN
TPGSYYCSCTLGFRLSSDGRSCEDVNECNSNPCSQECANVYGSYQCYCRRGYQLSDVDGV
TCEDIDECALPTGGHICSYRCINIPGSFQCSCPPTGYRLAPNGRNCQDIDECVTGIHNCS
INETCFNIQGSFRCLAFECPENYRRSTDALRQEKTDTVRCIKSCRPNDVACVLDPVHTIS
HTVVSLPTFREFTRPEEIIFLRAITPAYPANHADIIFDITDGNLRDSFDIIKRYMDGMTV
GVVRQVRPIVGPFHAVLKLEMNYVVGGVVSHRNVVSVHIFVSEYWF
Download sequence
Identical sequences F1MYN5
ENSBTAP00000016040 ENSBTAP00000016040

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]