SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSBTAP00000016055 from Bos taurus 76_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSBTAP00000016055
Domain Number 1 Region: 377-499
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 2.89e-28
Family SPRY domain 0.0011
Further Details:      
 
Domain Number 2 Region: 31-142
Classification Level Classification E-value
Superfamily Immunoglobulin 9.2e-22
Family V set domains (antibody variable domain-like) 0.00013
Further Details:      
 
Domain Number 3 Region: 153-229
Classification Level Classification E-value
Superfamily Immunoglobulin 0.000000000513
Family C1 set domains (antibody constant domain-like) 0.04
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSBTAP00000016055   Gene: ENSBTAG00000007618   Transcript: ENSBTAT00000016055
Sequence length 504
Comment pep:known chromosome:UMD3.1:23:25648712:25656497:1 gene:ENSBTAG00000007618 transcript:ENSBTAT00000016055 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MAGFPGLFPAGVLPALLLWVSMWGSPASGFSVMGPAQPIKVSLGADATLPCQLSSEQSAA
HMQIRWYRTQLSPAVLVYQDGQEQDGEQMLEYRGRTELVEDSIGRGAVALLIQHVRASDD
GQYWCHFNDGHISREAVVELHVIGLGSAPHVRMMGPEDHGIQVLCSSGGWFPKPRVQWSD
TAGEKLLSLSEYQTQDGDGLFHVEASLVVTDSSLGNVTCSIQNPVSGQEKASAIFLPEPF
FPRTSPWKIALAGTLPVLVLLLIGISYIGWKEHKAKNGEVEKRKKASHERDKVAREKEEA
HSLKRKLEEDLEQRKALYNKDWKKALIYPDWRKEQFERVLVIENHENVHQNNSDFRKEPQ
AVLCKEQGGGNLLKLDQKGFTKGRHYWEVDIEDTDEWTLGIYEEPTEKSELLSDLQKMKF
NVLEKKGCEYRALICSRQGIFHKESLPIEKCPLKIVIFLDYEDSDISFYNMTDETHIFSF
THTNFSGSVYPYFKLKSMEFSPSA
Download sequence
Identical sequences E1BJF0
ENSBTAP00000016055 ENSBTAP00000016055

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]