SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSBTAP00000016103 from Bos taurus 76_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSBTAP00000016103
Domain Number 1 Region: 467-600
Classification Level Classification E-value
Superfamily TIMP-like 1.69e-37
Family Netrin-like domain (NTR/C345C module) 0.01
Further Details:      
 
Domain Number 2 Region: 284-342
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000000001
Family Laminin-type module 0.03
Further Details:      
 
Domain Number 3 Region: 340-392
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000000053
Family Laminin-type module 0.022
Further Details:      
 
Domain Number 4 Region: 403-442
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000000977
Family Laminin-type module 0.012
Further Details:      
 
Domain Number 5 Region: 94-174
Classification Level Classification E-value
Superfamily Galactose-binding domain-like 0.0000118
Family Galactose-binding domain 0.046
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSBTAP00000016103   Gene: ENSBTAG00000012137   Transcript: ENSBTAT00000016103
Sequence length 603
Comment pep:known_by_projection chromosome:UMD3.1:19:29084419:29269338:1 gene:ENSBTAG00000012137 transcript:ENSBTAT00000016103 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MRAVWEALAALAAVACLVGAVRGGPGLSMFAGQAAQPDPCSDENGHPRRCIPDFVNAAFG
KDVRVSSTCGRPPARYCVVSERGEERLRSCHLCNASDPKKAHPPAFLTDLNNPHNLTCWQ
SENYLQFPHNVTLTLSLGKKFEVTYVSLQFCSPRPESMAIYKSMDYGRTWVPFQFYSTQC
RKMYNRPHRAPITKQNEQEAVCTDSHTDMRPLSGGLIAFSTLDGRPSAHDFDNSPVLQDW
VTATDIRVAFSRLHTFGDENEDDSELARDSYFYAVSDLQVGGRCKCNGHAARCVRDRDDS
LVCDCRHNTAGPECDRCKPFHYDRPWQRATAREANECVACNCNLHARRCRFNMELYKLSG
RKSGGVCLNCRHNTAGRHCHYCKEGYYRDLGKPITHRKACKACDCHPVGAAGKTCNQTTG
QCPCKDGVTGITCNRCAKGYQQSRSPIAPCIKIPVAPPTTAASSVEEPEDCDSYCKASKG
KLKINMKKYCKKDYAVQIHILKADKAGDWWKFTVNIISVYKQGTSRIRRGDQNLWIRSRD
IACKCPKIKPLKKYLLLGNAEDSPDQSGIVADKSSLVIQWRDTWARRLRKFQQREKKGKC
KKA
Download sequence
Identical sequences F1N0C7
ENSBTAP00000016103 ENSBTAP00000016103 NP_001179495.1.59421 NP_001179495.1.76553 XP_005220425.1.76553

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]