SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSBTAP00000016108 from Bos taurus 76_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSBTAP00000016108
Domain Number 1 Region: 6-128
Classification Level Classification E-value
Superfamily DNA clamp 1.5e-19
Family DNA polymerase processivity factor 0.0099
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSBTAP00000016108   Gene: ENSBTAG00000012141   Transcript: ENSBTAT00000016108
Sequence length 422
Comment pep:known chromosome:UMD3.1:29:45932485:45938364:1 gene:ENSBTAG00000012141 transcript:ENSBTAT00000016108 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MKCLVTGSNVKVLGKAVHSLSRIGDELYLEPLEDGLSLRTVNSSRSAYACFLFAPLFFQQ
YQAATPGQDQLRCKILMKSFLSVFRSLAMLEKTVEKCCISLNDRSSRLVVQLHCKYGVRK
THNLSFQDCESLQAVFDPALCPHVLRAPARVLVEAVLPFPPALAEVTLGIGHGRRVILRS
YQEEEADSAIKAMVTEMSIGEEDFQQLQAQEGVAITFCLKEFRVRFLPCTHCPVHLSSLP
SLHALLLPCQGLLSFAESANLSLSIHFDAPGRPAIFAIEDSLLDGHFVLATLSESDSHPQ
TLHAQEELQRPEPGPQAHSTPHLDLDDFAVDDMDSYMIAMETTTGSEGSRALPSISLSPG
LQRPCSSSPHSEEEDDDMEPSTVPGTPPPKKFRSLFFGSILAPAHSPQGPSPVLAEDSEG
EG
Download sequence
Identical sequences Q5EAC3
XP_010819354.1.76553 XP_015316740.1.76553 ENSBTAP00000042235 ENSBTAP00000016108

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]